Recombinant Human Cystatin-9 (CST9)

• Product Name Alternative:

  Cystatin-like molecule

• Abbreviation:

  Recombinant Human CST9 protein

• Gene Name:

  CST9

• UniProt:

  Q5W186

• Expression Region:

  29-159aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  WCSEEEMGGNNKIVQDPMFLATVEFALNTFNVQSKEEHAYRLLRVLSSWREDSMDRKWRGKMVFSMNLQLRQTVCRKFEDDIDNCPFQESLELNNVRQGISFPQVHSCGCCMGCGVGTGAADKAIPRDKGK

• Tag:

  N-terminal 6xHis-tagged

• Type:

  Developed Protein

• Source:

  E.coli

• Field of Research:

  Cell Biology

• Relevance:

  May be involved in testis development (By similarity) . May play a role in hematopoietic differentiation or inflammation (PubMed:12535658) . Has immunomodulatory and antimicrobial functions against Francisella tularensis, a Gram-negative bacteria (PubMed:23922243) .

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  May be involved in testis development (By similarity) . May play a role in hematopoietic differentiation or inflammation

• Molecular Weight:

  18.9 kDa

• References & Citations:

  "Molecular cloning and characterization of a novel cystatin-like molecule, CLM, from human bone marrow stromal cells."Sun H., Li N., Wang X., Liu S., Chen T., Zhang L., Wan T., Cao X.Biochem. Biophys. Res. Commun. 301:176-182 (2003)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length of Mature Protein