Products for Research Use Only
RegisterLogin

Recombinant Human Eukaryotic translation initiation factor 3 subunit M (EIF3M)

CAT: 0399-CSB-EP745333HU-01Size: 20 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0399-CSB-EP745333HU-01Size:20 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Product Name Alternative
Short name: eIF3m Alternative name (s) : Fetal lung protein B5 Short name: hFL-B5 PCI domain-containing protein 1
Abbreviation
Recombinant Human EIF3M protein
Gene Name
EIF3M
UniProt
Q7L2H7
Expression Region
2-374aa
Organism
Homo sapiens (Human)
Target Sequence
SVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKWISDWNLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQELQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLYDTLNAWKQNLNKVKNSLLSLSDT
Tag
N-terminal 6xHis-SUMO-tagged
Type
In Stock Protein
Source
E.coli
Field of Research
Others
Relevance
Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S preinitiation complex (43S PIC) . The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. May favor virus entry in case of infection with herpes simplex virus 1 (HSV1) or herpes simplex virus 2 (HSV2) .
Endotoxin
Not test
Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Function
Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis
Molecular Weight
58.4 kDa
References & Citations
"A new class of receptor for herpes simplex virus has heptad repeat motifs that are common to membrane fusion proteins."Perez A., Li Q.-X., Perez-Romero P., DeLassus G., Lopez S.R., Sutter S., McLaren N., Fuller A.O.J. Virol. 79:7419-7430 (2005) .
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Full Length of Mature Protein

UniProtKB · Q7L2H7

Eukaryotic translation initiation factor 3 subunit M

EIF3M_HUMAN · Homo sapiens

View on UniProt ↗
Primary accession
Q7L2H7
Review status
UniProtKB reviewed (Swiss-Prot)
Gene
EIF3M
Protein existence
1: Evidence at protein level
Organism
Homo sapiens (Human)
Taxonomy ID
9606
Alternative names
eIF3m
EC number
—
Processing
—
Secondary accessions
A8K7X4, B4E2Q4, O60735, Q2F836, Q53HL6, Q9BXW1
Protein keywords

Technical term

3D-structureDirect protein sequencingProteomics identificationReference proteome

PTM

AcetylationPhosphoprotein

Coding sequence diversity

Alternative splicing

Cellular component

Cytoplasm

Biological process

Host-virus interactionProtein biosynthesis

Molecular function

Initiation factor

Related Products

CatalogName
CSB-RP031054h-01Human Eukaryotic translation initiation factor 3 subunit F (EIF3F)
CSB-EP007536HU-01Recombinant Human Eukaryotic translation initiation factor 3 subunit G (EIF3G)
CSB-EP007535HU-01Recombinant Human Eukaryotic translation initiation factor 3 subunit F (EIF3F)
CSB-EP866204HU-01Recombinant Human Eukaryotic translation initiation factor 3 subunit K (EIF3K)
CSB-EP007534HUc7-01Recombinant Human Eukaryotic translation initiation factor 3 subunit E (EIF3E)
CSB-EP007534HU-01Recombinant Human Eukaryotic translation initiation factor 3 subunit E (EIF3E)
CSB-BP007538RA-01Recombinant Rat Eukaryotic translation initiation factor 3 subunit I (Eif3i)
CSB-EP007538RA-01Recombinant Rat Eukaryotic translation initiation factor 3 subunit I (Eif3i)
CSB-EP007535HU1-01Recombinant Human Eukaryotic translation initiation factor 3 subunit F (EIF3F), partial
CSB-RP051144h-01Recombinant Human Eukaryotic translation initiation factor 1 (EIF1)

Alternative Products

CatalogName
480043EIF3M (Eukaryotic Translation Initiation Factor 3 Subunit M)
abx318871-01Eukaryotic Translation Initiation Factor 3 Subunit M (EIF3M) Antibody
MBS9423607-01Recombinant Human Eukaryotic translation initiation factor 3 subunit M (EIF3M)
abx317444-01Eukaryotic Translation Initiation Factor 3 Subunit M (EIF3M) Antibody (HRP)
MBS1470747-01Recombinant Bovine Eukaryotic translation initiation factor 3 subunit M (EIF3M)
abx317445-01Eukaryotic Translation Initiation Factor 3 Subunit M (EIF3M) Antibody (FITC)
AP74027-01Recombinant Human Eukaryotic translation initiation factor 3 subunit M(EIF3M)
MBS1292562-01Recombinant Mouse Eukaryotic translation initiation factor 3 subunit M (Eif3m)
MBS1369622-01Recombinant Chicken Eukaryotic translation initiation factor 3 subunit M (EIF3M)
abx317446-01Eukaryotic Translation Initiation Factor 3 Subunit M (EIF3M) Antibody (Biotin)

Popular Products