Recombinant Escherichia coli Elongation factor P (efp)

CAT:
399-CSB-EP358853ENV-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Escherichia coli Elongation factor P (efp) - image 1

Recombinant Escherichia coli Elongation factor P (efp)

  • Product Name Alternative:

    Short name:EF-P
  • Abbreviation:

    Recombinant E.coli efp protein
  • Gene Name:

    Efp
  • UniProt:

    P0A6N4
  • Expression Region:

    2-188aa
  • Organism:

    Escherichia coli (strain K12)
  • Target Sequence:

    ATYYSNDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNLTYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVIKVDTRSGEYVSRVK
  • Tag:

    N-terminal 6xHis-SUMO-tagged
  • Type:

    Developed Protein
  • Source:

    E.coli
  • Field of Research:

    Others
  • Relevance:

    Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Beta-lysylation at Lys-34 is required for alleviation. The Pro codons and their context do not affect activity; only consecutive Pro residues (not another amino acid) are affected by EF-P. Has stimulatory effects on peptide bond formation between ribosome-bound initiator tRNA (fMet) and puromycin, and N-acetyl-Phe tRNA (Phe) -primed poly (U) -directed poly (Phe) synthesis.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function:

    Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Beta-lysylation at Lys-34 is required for alleviation. The Pro codons and their context do not affect activity; only consecutive Pro residues (not another amino acid) are affected by EF-P. Has stimulatory effects on peptide bond formation between ribosome-bound initiator tRNA (fMet) and puromycin, and N-acetyl-Phe tRNA (Phe) -primed poly (U) -directed poly (Phe) synthesis.
  • Molecular Weight:

    36.5 kDa
  • References & Citations:

    "Cloning, sequencing and overexpression of the gene for prokaryotic factor EF-P involved in peptide bond synthesis."Aoki H., Adams S.-L., Chung D.-G., Yaguchi M., Chuang S.-E., Ganoza M.C.Nucleic Acids Res. 19:6215-6220 (1991)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length of Mature Protein