Recombinant Salmonella typhi LPS-assembly protein LptD (lptD), partial

CAT:
399-CSB-EP845655SWW-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Salmonella typhi LPS-assembly protein LptD (lptD), partial - image 1

Recombinant Salmonella typhi LPS-assembly protein LptD (lptD), partial

  • Product Name Alternative:

    LptD; imp; ostA; STY0108; t0096LPS-assembly protein LptD
  • Abbreviation:

    Recombinant Salmonella typhi lptD protein, partial
  • Gene Name:

    LptD
  • UniProt:

    Q8Z9J6
  • Expression Region:

    73-169aa
  • Organism:

    Salmonella typhi
  • Target Sequence:

    VDIMQGNSRLQADEVQLHQKQAEGQPEPVRTVDALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDYQMVGRQGRGKADLMKQRGENRYTILENGS
  • Tag:

    N-terminal 6xHis-SUMO-tagged
  • Type:

    Developed Protein
  • Source:

    E.coli
  • Field of Research:

    Others
  • Relevance:

    Together with LptE, is involved in the assembly of lipopolysaccharide (LPS) at the surface of the outer membrane.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function:

    Together with LptE, is involved in the assembly of lipopolysaccharide (LPS) at the surface of the outer membrane.
  • Molecular Weight:

    26.9 kDa
  • References & Citations:

    "Complete genome sequence of a multiple drug resistant Salmonella enterica serovar Typhi CT18."Parkhill J., Dougan G., James K.D., Thomson N.R., Pickard D., Wain J., Churcher C.M., Mungall K.L., Bentley S.D., Holden M.T.G., Sebaihia M., Baker S., Basham D., Brooks K., Chillingworth T., Connerton P., Cronin A., Davis P. Barrell B.G.Nature 413:848-852 (2001)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Partial