Recombinant Rat Ribosyldihydronicotinamide dehydrogenase (Nqo2)

CAT:
399-CSB-YP721470RA-01
Size:
20 µg

For Laboratory Research Only. Not for Clinical or Personal Use.

  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Rat Ribosyldihydronicotinamide dehydrogenase (Nqo2) - image 1

Recombinant Rat Ribosyldihydronicotinamide dehydrogenase (Nqo2)

  • Product Name Alternative:

    NRH dehydrogenase [quinone] 2NRH:quinone oxidoreductase 2Quinone reductase 2 ; QR2
  • Abbreviation:

    Recombinant Rat Nqo2 protein
  • Gene Name:

    Nqo2
  • UniProt:

    Q6AY80
  • Expression Region:

    1-231aa
  • Organism:

    Rattus norvegicus (Rat)
  • Target Sequence:

    MAGKKVLLVYAHQEPKSFNGSMKQVAVEELSKQGCTVTVSDLYTMNFEPRATRNDVTGALSNPEVFKYGIEAYEAYKKKALTSDILEEQRKVQEADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDVPGFYDSGFLKDKLALLSFTTGGTAEMYTKAGVNGDFRYFLWPLQHGTLHFCGFKVLAPQISFGPEVSSEEQRKVMLASWVQRLKSIWKEEPIHCTPSWYFQG
  • Tag:

    N-terminal 6xHis-tagged
  • Type:

    Developed Protein
  • Source:

    Yeast
  • Field of Research:

    Others
  • Relevance:

    The enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinones involved in detoxification pathways as well as in biosynthetic processes such as the vitamin K-dependent gamma-carboxylation of glutamate residues in prothrombin synthesis.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function:

    The enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinones involved in detoxification pathways as well as in biosynthetic processes such as the vitamin K-dependent gamma-carboxylation of glutamate residues in prothrombin synthesis.
  • Molecular Weight:

    28.3 kDa
  • References & Citations:

    "Disruption of dihydronicotinamide riboside:quinone oxidoreductase 2 (NQO2) leads to myeloid hyperplasia of bone marrow and decreased sensitivity to menadione toxicity."Long D.J., Iskander K., Gaikwad A., Arin M., Roop D.R., Knox R., Barrios R., Jaiswal A.K.J. Biol. Chem. 277:46131-46139 (2002)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length