Recombinant Crotalus adamanteus Thrombin-like enzyme crotalase

CAT:
399-CSB-YP520546DYB-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Crotalus adamanteus Thrombin-like enzyme crotalase - image 1

Recombinant Crotalus adamanteus Thrombin-like enzyme crotalase

  • Product Name Alternative:

    Thrombin-like enzyme crotalase; SVTLE; EC 3.4.21.74; Fibrinogen-clotting enzyme; Snake venom serine protease 2; SVSP
  • Abbreviation:

    Recombinant Crotalus adamanteus Thrombin-like enzyme crotalase protein
  • UniProt:

    F8S114
  • Expression Region:

    25-262aa
  • Organism:

    Crotalus adamanteus (Eastern diamondback rattlesnake)
  • Target Sequence:

    VIGGDECNINEHRFLVALYDYWSQSFLCGGTLINEEWVLTAKHCDRTHILIYVGVHDRSVQFDKEQRRFPKEKYFFDCSNNFTKWDKDIMLIRLNKPVSYSEHIAPLSLPSSPPIVGSVCRAMGWGQTTSPQETLPDVPHCANINLLDYEVCRTAHPQFRLPATSRTLCAGVLEGGIDTCNRDSGGPLICNGQFQGIVFWGPDPCAQPDKPGLYTKVFDHLDWIQSIIAGEKTVNCPP
  • Tag:

    N-terminal 6xHis-tagged
  • Type:

    Developed Protein
  • Source:

    Yeast
  • Field of Research:

    Others
  • Relevance:

    Thrombin-like snake venom protein that release fibrinopeptide A from fibrinogen (FGA) . Shows both kinin-releasing and coagulant activities.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function:

    Thrombin-like snake venom protein that release fibrinopeptide A from fibrinogen (FGA) . Shows both kinin-releasing and coagulant activities.
  • Molecular Weight:

    28.8 kDa
  • References & Citations:

    Kallikrein-like activity of crotalase, a snake venom enzyme that clots fibrinogen.Markland F.S., Kettner C., Schiffman S., Shaw E., Bajwa S.S., Reddy K.N., Kirakossian H., Patkos G.B., Theodor I., Pirkle H.Proc. Natl. Acad. Sci. U.S.A. 79:1688-1692 (1982)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length of Mature Protein