Recombinant Rat Regucalcin (Rgn)

CAT:
399-CSB-YP019630RA-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Rat Regucalcin (Rgn) - image 1

Recombinant Rat Regucalcin (Rgn)

  • Product Name Alternative:

    Gluconolactonase (EC:3.1.1.17) Short name: GNL Senescence marker protein 30 Short name: SMP-30
  • Abbreviation:

    Recombinant Rat Rgn protein
  • Gene Name:

    Rgn
  • UniProt:

    Q03336
  • Expression Region:

    1-299aa
  • Organism:

    Rattus norvegicus (Rat)
  • Target Sequence:

    MSSIKIECVLRENYRCGESPVWEEASKCLLFVDIPSKTVCRWDSISNRVQRVGVDAPVSSVALRQSGGYVATIGTKFCALNWEDQSVFILAMVDEDKKNNRFNDGKVDPAGRYFAGTMAEETAPAVLERHQGSLYSLFPDHSVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYTVDAFDYDLPTGQISNRRTVYKMEKDEQIPDGMCIDVEGKLWVACYNGGRVIRLDPETGKRLQTVKLPVDKTTSCCFGGKDYSEMYVTCARDGMSAEGLLRQPDAGNIFKITGLGVKGIAPYSYAG
  • Tag:

    N-terminal 6xHis-tagged
  • Type:

    Developed Protein
  • Source:

    Yeast
  • Field of Research:

    Others
  • Relevance:

    Gluconolactonase with low activity towards other sugar lactones, including gulonolactone and galactonolactone. Catalyzes a key step in ascorbic acid (vitamin C) biosynthesis. Can also hydrolyze diisopropyl phosphorofluoridate and phenylacetate (in vitro) . Calcium-binding protein. Modulates Ca2+ signaling, and Ca2+-dependent cellular processes and enzyme activities.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function:

    Gluconolactonase with low activity towards other sugar lactones, including gulonolactone and galactonolactone. Catalyzes a key step in ascorbic acid (vitamin C) biosynthesis. Can also hydrolyze diisopropyl phosphorofluoridate and phenylacetate (in vitro) . Calcium-binding protein. Modulates Ca (2+) signaling, and Ca (2+) -dependent cellular processes and enzyme activities.
  • Molecular Weight:

    35.4 kDa
  • References & Citations:

    "Senescence marker protein-30 is a unique enzyme that hydrolyzes diisopropyl phosphorofluoridate in the liver."Kondo Y., Ishigami A., Kubo S., Handa S., Gomi K., Hirokawa K., Kajiyama N., Chiba T., Shimokado K., Maruyama N.FEBS Lett. 570:57-62 (2004)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length