Recombinant Human Nicotinate phosphoribosyltransferase (NAPRT), partial

• Product Name Alternative:

  FHA-HIT-interacting proteinNicotinate phosphoribosyltransferase domain-containing protein 1

• Abbreviation:

  Recombinant Human NAPRT1 protein, partial

• Gene Name:

  NAPRT1

• UniProt:

  Q6XQN6

• Expression Region:

  229-538aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  MLAPAAGEGPGVDLAAKAQVWLEQVCAHLGLGVQEPHPGERAAFVAYALAFPRAFQGLLDTYSVWRSGLPNFLAVALALGELGYRAVGVRLDSGDLLQQAQEIRKVFRAAAAQFQVPWLESVLIVVSNNIDEEALARLAQEGSEVNVIGIGTSVVTCPQQPSLGGVYKLVAVGGQPRMKLTEDPEKQTLPGSKAAFRLLGSDGSPLMDMLQLAEEPVPQAGQELRVWPPGAQEPCTVRPAQVEPLLRLCLQQGQLCEPLPSLAESRALAQLSLSRLSPEHRRLRSPAQYQVVLSERLQALVNSLCAGQSP

• Tag:

  N-terminal 6xHis-tagged

• Type:

  Developed Protein

• Source:

  Yeast

• Field of Research:

  Metabolism

• Relevance:

  Catalyzes the conversion of nicotinic acid (NA) to NA mononucleotide (NaMN) . Essential for NA to increase cellular NAD levels and prevent oxidative stress of the cells.

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Catalyzes the conversion of nicotinic acid (NA) to NA mononucleotide (NaMN) . Essential for NA to increase cellular NAD levels and prevent oxidative stress of the cells.

• Molecular Weight:

  35.2 kDa

• References & Citations:

  Elevation of cellular NAD levels by nicotinic acid and involvement of nicotinic acid phosphoribosyltransferase in human cells.Hara N., Yamada K., Shibata T., Osago H., Hashimoto T., Tsuchiya M.J. Biol. Chem. 282:24574-24582 (2007)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial