Recombinant Human Leptin (LEP), partialRecombinant Human Leptin (LEP), partial - High-quality laboratory reagent available from Gentaur. Catalog: 399-CSB-RP067974h-01.399-CSB-RP067974h-01399-CSB-RP067974h-01Business & Industrial > Science & LaboratoryRecombinant Human Leptin (LEP), partial
Gentaur
EUR12027-02-21

Recombinant Human Leptin (LEP), partial

CAT:
399-CSB-RP067974h-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human Leptin (LEP), partial - image 1

Recombinant Human Leptin (LEP), partial

  • Product Name Alternative:

    Obese proteinObesity factor
  • Abbreviation:

    Recombinant Human LEP protein, partial
  • Gene Name:

    LEP
  • UniProt:

    P41159
  • Expression Region:

    29-164aa
  • Organism:

    Homo sapiens (Human)
  • Target Sequence:

    DDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLS
  • Tag:

    N-terminal 6xHis-tagged
  • Type:

    In Stock Protein
  • Source:

    E.coli
  • Field of Research:

    Signal Transduction
  • Relevance:

    May function as part of a signaling pathway that acts to regulate the size of the body fat depot. An increase in the level of LEP may act directly or indirectly on the CNS to inhibit food intake and/or regulate energy expenditure as part of a homeostatic mechanism to maintain constancy of the adipose mass.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function:

    Key player in the regulation of energy balance and body weight control. Once released into the circulation, has central and peripheral effects by binding LEPR, found in many tissues, which results in the activation of several major signaling pathways
  • Molecular Weight:

    19 kDa
  • References & Citations:

    A leptin missense mutation associated with hypogonadism and morbid obesity.Strobel A., Issad T., Camoin L., Ozata M., Strosberg A.D.Nat. Genet. 18:213-215 (1998)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Partial