Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 (NDUFB7)

CAT:
399-CSB-RP015944h-01
Size:
20 µg

For Laboratory Research Only. Not for Clinical or Personal Use.

  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 (NDUFB7) - image 1

Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 (NDUFB7)

  • Product Name Alternative:

    Cell adhesion protein SQM1Complex I-B18 ; CI-B18NADH-ubiquinone oxidoreductase B18 subunit
  • Abbreviation:

    Recombinant Human NDUFB7 protein
  • Gene Name:

    NDUFB7
  • UniProt:

    P17568
  • Expression Region:

    2-137aa
  • Organism:

    Homo sapiens (Human)
  • Target Sequence:

    GAHLVRRYLGDASVEPDPLQMPTFPPDYGFPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKVAL
  • Tag:

    N-terminal GST-tagged
  • Type:

    Developed Protein
  • Source:

    E.coli
  • Field of Research:

    Transport
  • Relevance:

    Accessory subunit of the mitochondrial mbrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function:

    Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
  • Molecular Weight:

    43.3 kDa
  • References & Citations:

    CDNA cloning of a novel cell adhesion protein expressed in human squamous carcinoma cells.Wong Y.-C., Tsao S.-W., Kakefuda M., Bernal S.D.Biochem. Biophys. Res. Commun. 166:984-992 (1990)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length of Mature Protein