Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H5 (ITIH5), partial

CAT:
399-CSB-EP768213HU-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H5 (ITIH5), partial - image 1

Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H5 (ITIH5), partial

  • Product Name Alternative:

    ITIH5; KIAA1953; PP14776; UNQ311/PRO354; Inter-alpha-trypsin inhibitor heavy chain H5; ITI heavy chain H5; ITI-HC5; Inter-alpha-inhibitor heavy chain 5
  • Abbreviation:

    Recombinant Human ITIH5 protein, partial
  • Gene Name:

    ITIH5
  • UniProt:

    Q86UX2
  • Expression Region:

    35-161aa
  • Organism:

    Homo sapiens (Human)
  • Target Sequence:

    VPRQVRLLQRLKTKPLMTEFSVKSTIISRYAFTTVSCRMLNRASEDQDIEFQMQIPAAAFITNFTMLIGDKVYQGEITEREKKSGDRVKEKRNKTTEENGEKGTEIFRASAVIPSKDKAAFFLSYEE
  • Tag:

    N-terminal 6xHis-SUMO-tagged
  • Type:

    In Stock Protein
  • Source:

    E.coli
  • Field of Research:

    Cancer
  • Relevance:

    May act as a tumor suppressor.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function:

    May act as a tumor suppressor.
  • Molecular Weight:

    30.6 kDa
  • References & Citations:

    ITIH5, a novel member of the inter-alpha-trypsin inhibitor heavy chain family is downregulated in breast cancer.Himmelfarb M., Klopocki E., Grube S., Staub E., Klaman I., Hinzmann B., Kristiansen G., Rosenthal A., Duerst M., Dahl E.Cancer Lett. 204:69-77 (2004)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Partial