Recombinant Bovine Adiponectin (ADIPOQ)

CAT:
399-CSB-EP661101BO-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Bovine Adiponectin (ADIPOQ) - image 1

Recombinant Bovine Adiponectin (ADIPOQ)

  • Product Name Alternative:

    30KDA adipocyte complement-related protein; Adipocyte complement-related 30KDA protein ; ACRP30Adipocyte, C1q and collagen domain-containing protein; Adipose most abundant gene transcript 1 protein ; apM-1
  • Abbreviation:

    Recombinant Bovine ADIPOQ protein
  • Gene Name:

    ADIPOQ
  • UniProt:

    Q3Y5Z3
  • Expression Region:

    18-240aa
  • Organism:

    Bos taurus (Bovine)
  • Target Sequence:

    EDNMEDPPLPKGACAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDPGLVGPKGDTGETGITGIEGPRGFPGTPGRKGEPGESAYVYRSAFSVGLERQVTVPNVPIRFTKIFYNQQNHYDGTTGKFLCNIPGLYYFSYHITVYLKDVKVSLYKNDKALLFTHDQFQDKNVDQASGSVLLYLEKGDQVWLQVYEGENHNGVYADNVNDSTFTGFLLYHNIVE
  • Tag:

    N-terminal 6xHis-SUMO-tagged
  • Type:

    Developed Protein
  • Source:

    E.coli
  • Field of Research:

    Others
  • Relevance:

    Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue rodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW .
  • Endotoxin:

    Not test
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function:

    Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW (By similarity) .
  • Molecular Weight:

    40.4 kDa
  • References & Citations:

    Identification and adipocyte differentiation-dependent expression of the unique disialic acid residue in an adipose tissue-specific glycoprotein, adipo Q.Sato C., Yasukawa Z., Honda N., Matsuda T., Kitajima K.J. Biol. Chem. 276:28849-28856 (2001)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length of Mature Protein