Recombinant Micrurus tener tener Kunitz-type neurotoxin MitTx-alpha

CAT:
399-CSB-EP516846MUA-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Micrurus tener tener Kunitz-type neurotoxin MitTx-alpha - image 1

Recombinant Micrurus tener tener Kunitz-type neurotoxin MitTx-alpha

  • Product Name Alternative:

    ; Kunitz-type neurotoxin MitTx-alpha
  • Abbreviation:

    Recombinant Micrurus tener tener Kunitz-type neurotoxin MitTx-alpha protein
  • UniProt:

    G9I929
  • Expression Region:

    25-84aa
  • Organism:

    Micrurus tener tener (Texas coral snake)
  • Target Sequence:

    QIRPAFCYEDPPFFQKCGAFVDSYYFNRSRITCVHFFYGQCDVNQNHFTTMSECNRVCHG
  • Tag:

    N-terminal 6xHis-SUMO-tagged
  • Type:

    Developed Protein
  • Source:

    E.coli
  • Field of Research:

    Others
  • Relevance:

    This heterodimeric toxin potently activates mouse acid-sensing ion channel ASIC1/ACCN2 expressed in Xenopus oocytes. Both alternatively spliced isoforms ASIC1a and ASIC1b are activated, with a higher potency for ASIC1a (EC (50) =9.4 nM) vs ASIC1b (EC (50) =23 nM) . The ASIC3/ACCN3 subtype is also sensitive to the heterodimer, but with a lower potency (EC (50) =830 nM) . On ASIC2a/ACCN1, the toxin shows a very weak activation, but produces a rarkable potentiation (>100-fold) of protons when the Extracellular domain pH drops below neutrality. The toxin interacts with the Extracellular domain region of the channel, since responses are only observed in the outside-out configuration. In vivo, the heterodimer elicits robust pain-related behavior in mice by activation of ASIC1/ACCN2 channels on capsaicin-sensitive nerve fibers.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function:

    MitTx, a heteromeric complex between Kunitz- and phospholipase-A2-like proteins, potently, persistently and selectively activates rat and chicken acid-sensing ion channel ASIC1
  • Molecular Weight:

    23.1 kDa
  • References & Citations:

    A heteromeric Texas coral snake toxin targets acid-sensing ion channels to produce pain.Bohlen C.J., Chesler A.T., Sharif-Naeini R., Medzihradszky K.F., Zhou S., King D., Sanchez E.E., Burlingame A.L., Basbaum A.I., Julius D.Nature 479:410-414 (2011)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length of Mature Protein