Recombinant Bacillus thuringiensis subsp. Pesticidal crystal protein cry1Ac (cry1Ac), partial

CAT:
399-CSB-EP356448BDC-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Bacillus thuringiensis subsp. Pesticidal crystal protein cry1Ac (cry1Ac), partial - image 1

Recombinant Bacillus thuringiensis subsp. Pesticidal crystal protein cry1Ac (cry1Ac), partial

  • Product Name Alternative:

    133KDA crystal protein; Crystaline entomocidal protoxinInsecticidal delta-endotoxin CryIA (c)
  • Abbreviation:

    Recombinant Bacillus thuringiensis subsp. kurstaki cry1Ac protein, partial
  • Gene Name:

    Cry1Ac
  • UniProt:

    P05068
  • Expression Region:

    972-1178aa
  • Organism:

    Bacillus thuringiensis subsp. kurstaki
  • Target Sequence:

    LYDARNVIKNGDFNNGLSCWNVKGHVDVEEQNNQRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEEIYPNNTVTCNDYTVNQEEYGGAYTSRNRGYNEAPSVPADYASVYEEKSYTDGRRENPCEFNRGYRDYTPLPVGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
  • Tag:

    N-terminal GST-tagged
  • Type:

    In Stock Protein
  • Source:

    E.coli
  • Field of Research:

    Others
  • Relevance:

    Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function:

    Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae.
  • Molecular Weight:

    50.8 kDa
  • References & Citations:

    Characterized full-length and truncated plasmid clones of the crystal protein of Bacillus thuringiensis subsp. kurstaki HD-73 and their toxicity to Manduca sexta.Adang M.J., Staver M.J., Rocheleau T.A., Leighton J., Barker R.F., Thompson D.V.Gene 36:289-300 (1985)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Partial