Recombinant Sulfolobus solfataricus DNA-binding protein 7d (sso7d)

CAT:
399-CSB-EP334566FPM-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Sulfolobus solfataricus DNA-binding protein 7d (sso7d) - image 1

Recombinant Sulfolobus solfataricus DNA-binding protein 7d (sso7d)

  • Product Name Alternative:

    7KDA DNA-binding protein dSso7d
  • Abbreviation:

    Recombinant Sulfolobus solfataricus sso7d protein
  • Gene Name:

    Sso7d
  • UniProt:

    P39476
  • Expression Region:

    2-64aa
  • Organism:

    Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
  • Target Sequence:

    ATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK
  • Tag:

    N-terminal 6xHis-SUMO-tagged
  • Type:

    In Stock Protein
  • Source:

    E.coli
  • Field of Research:

    Others
  • Relevance:

    Constrain negative DNA supercoils; may be involved in maintaining the integrity of their genome at high tperature. Stimulates the Holliday junction cleavage activity of Hjc.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function:

    Can constrain negative DNA supercoils. May be involved in maintaining the integrity of the genome at high temperature (By similarity) . Stimulates the Holliday junction cleavage activity of Hjc
  • Molecular Weight:

    23.1 kDa
  • References & Citations:

    The complete genome of the crenarchaeon Sulfolobus solfataricus P2.She Q., Singh R.K., Confalonieri F., Zivanovic Y., Allard G., Awayez M.J., Chan-Weiher C.C.-Y., Clausen I.G., Curtis B.A., De Moors A., Erauso G., Fletcher C., Gordon P.M.K., Heikamp-de Jong I., Jeffries A.C., Kozera C.J., Medina N., Peng X. , Thi-Ngoc H.P., Redder P., Schenk M.E., Theriault C., Tolstrup N., Charlebois R.L., Doolittle W.F., Duguet M., Gaasterland T., Garrett R.A., Ragan M.A., Sensen C.W., Van der Oost J.Proc. Natl. Acad. Sci. U.S.A. 98:7835-7840 (2001)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length of Mature Protein