Recombinant Human Complement C4-B (C4B), partial

CAT: 0399-CSB-EP313364HU-01Size: 20 µgDry Ice: NoHazardous: No
CAT#:0399-CSB-EP313364HU-01Size:20 µg
Selected
PRICE
AVAILABILITY: InStock
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Product image 1
1 / 1
Product Name Alternative
Basic complement C4C3 and PZP-like alpha-2-macroglobulin domain-containing protein 3
Abbreviation
Recombinant Human C4B protein, partial
Gene Name
C4B
UniProt
P0C0L5
Expression Region
1454-1744aa
Organism
Homo sapiens (Human)
Target Sequence
EAPKVVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRADLEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV
Tag
N-terminal 6xHis-SUMO-tagged
Type
In Stock Protein
Source
E.coli
Field of Research
Immunology
Relevance
Non-enzymatic component of the C3 and C5 convertases and thus essential for the propagation of the classical complent pathway. Covalently binds to immunoglobulins and immune complexes and enhances the solubilization of immune aggregates and the clearance of IC through CR1 on erythrocytes. C4A isotype is responsible for effective binding to form amide bonds with immune aggregates or protein antigens, while C4B isotype catalyzes the transacylation of the thioester carbonyl group to form ester bonds with carbohydrate antigens.Derived from proteolytic degradation of complent C4, C4a anaphylatoxin is a mediator of local inflammatory process. It induces the contraction of smooth muscle, increases vascular permeability and causes histamine release from mast cells and basophilic leukocytes.
Endotoxin
Not test
Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Function
Non-enzymatic component of the C3 and C5 convertases and thus essential for the propagation of the classical complement pathway. Covalently binds to immunoglobulins and immune complexes and enhances the solubilization of immune aggregates and the clearance of IC through CR1 on erythrocytes. C4A isotype is responsible for effective binding to form amide bonds with immune aggregates or protein antigens, while C4B isotype catalyzes the transacylation of the thioester carbonyl group to form ester bonds with carbohydrate antigens.; FUNCTION
Molecular Weight
49.1 kDa
References & Citations
Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry.Ramachandran P., Boontheung P., Xie Y., Sondej M., Wong D.T., Loo J.A.J. Proteome Res. 5:1493-1503 (2006)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Partial

Related Products

CatalogName
CSB-EP003950MO-01Recombinant Mouse Complement C4-B (C4b), partial
CSB-EP003950MOa0-01Recombinant Mouse Complement C4-B (C4b), partial
CSB-E09302h-01Human Complement fragment 4b, C4b ELISA Kit
CSB-E08705h-01Human Complement 4, C4 ELISA Kit
CSB-E08707m-01Mouse Complement 4, C4 ELISA Kit
CSB-E08706r-01Rat Complement 4, C4 ELISA Kit
CSB-EQ027970DO-01Dog Complement 4 (C4) ELISA kit
CSB-E16529Mk-01Monkey Complement 4 (C4) ELISA kit
CSB-EL003949BO-01Bovine Complement 4 (C4) ELISA kit
CSB-EP355590HU-01Recombinant Human Complement C3 (C3), partial

Alternative Products

CatalogName
052953C4B (Complement C4-B)
MBS9019843-01Recombinant Mouse Complement C4-B (C4b), partial
RPC22377-01Recombinant Human Complement C4-B (C4B), partial
AP72872-01Recombinant Human Complement C4-B(C4B), partial
AP70971-01Recombinant Human Complement C4-B(C4B)，partial
MBS2162355-01Active Complement C4-B (C4B)
MBS2122805-01Recombinant Complement C4-B (C4B)
abx175970-01Complement C4-B (C4B) Antibody
FY-AB47074-01Anti-Complement C4-B (C4B)

Popular Products