Recombinant Human Butyrophilin subfamily 3 member A2 (BTN3A2), partial

CAT:
399-CSB-EP002874HU-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human Butyrophilin subfamily 3 member A2 (BTN3A2), partial - image 1

Recombinant Human Butyrophilin subfamily 3 member A2 (BTN3A2), partial

  • Product Name Alternative:

    BT3.2; BT3.3; BT3A2_HUMAN; BTF4; BTN3A 2; BTN3A2; Butyrophilin protein; Butyrophilin subfamily 3 member A2; Butyrophilin; subfamily 3; member A2; CD277; FLJ40011
  • Abbreviation:

    Recombinant Human BTN3A2 protein, partial
  • Gene Name:

    BTN3A2
  • UniProt:

    P78410
  • Expression Region:

    30-248aa
  • Organism:

    Homo sapiens (Human)
  • Target Sequence:

    QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPW
  • Tag:

    N-terminal 6xHis-SUMO-tagged
  • Type:

    Developed Protein
  • Source:

    E.coli
  • Field of Research:

    Immunology
  • Relevance:

    Plays a role in T-cell responses in the adaptive immune response. Inhibits the release of IFNG from activated T-cells.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function:

    Plays a role in T-cell responses in the adaptive immune response. Inhibits the release of IFNG from activated T-cells.
  • Molecular Weight:

    39.6 kDa
  • References & Citations:

    The molecular basis for modulation of human Vgamma9Vdelta2 T cell responses by CD277/butyrophilin-3 (BTN3A) -specific antibodies.Palakodeti A., Sandstrom A., Sundaresan L., Harly C., Nedellec S., Olive D., Scotet E., Bonneville M., Adams E.J.J. Biol. Chem. 287:32780-32790 (2012)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Extracellular Domain