TRPV5 Antibody

• Catalog number
  R32330
• Price
  Please ask
• Size
  0.1mg

• Category
  Antibody
• Concentration
  0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Form
  Antigen affinity purified
• Conjugation
  Unconjugated
• Clone
  Polyclonal antibody
• Recognised antigen
  TRPV5
• Host animal
  Rabbit (Oryctolagus cuniculus)
• Clonality
  Polyclonal (rabbit origin)
• Species reactivity
  Human (Homo sapiens), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
• Tested applications
  WB
• Recommended dilutions
  Western blot: 0.1-0.5ug/ml
• Notes
  Optimal dilution of the TRPV5 antibody should be determined by the researcher.
• Intented use
  This TRPV5 antibodyis to be used only for research purposes and not for diagnostics..
• Uniprot
  Q9NQA5
• Purity
  Antigen affinity
• Description
  Transient receptor potential cation channel subfamily V member 5 is a protein that in humans is encoded by the TRPV5 gene. This gene is a member of the transient receptor family and the TrpV subfamily. The calcium-selective channel encoded by this gene has 6 transmembrane-spanning domains, multiple potential phosphorylation sites, an N-linked glycosylation site, and 5 ANK repeats. And this protein forms homotetramers or heterotetramers and is activated by a low internal calcium level. In addition, TRPV5 is mainly expressed in kidney epithelial cells, where it plays an important role in the reabsorption of Ca2+. Genetic deletion of TRPV5 in mice leads to Ca2+ loss in the urine, and consequential hyperparathyroidism, and bone loss.
• Immunogen
  Amino acids DTHWRVAQERDELWRAQVVATTVMLERKLPR of human TRPV5 were used as the immunogen for the TRPV5 antibody.
• Storage
  After reconstitution, the TRPV5 antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
• Properties
  If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  TRPV5  
• Gene symbol
  TRPV5
• Short name
  Anti-TRPV5
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Isotype
  Rabbit IgG
• Alternative name
  Antibodies to TRPV5
• Alternative technique
  antibodies

Gene info

• Identity
  HGNC:3145
• Gene
  TRPV5
• Long gene name
  transient receptor potential cation channel subfamily V member 5
• Synonyms gene
  • ECAC1
• Synonyms gene name
  • epithelial calcium channel 1
  • transient receptor potential cation channel, subfamily V, member 5
• Synonyms
  • CaT2
• GenBank acession
  • AJ271207
• Locus
  7q34
• Discovery year
  2000-05-05
• Entrez gene record
  56302
• Pubmed identfication
  • 10944439
  • 10945469
  • 16382100
• RefSeq identity
  • NM_019841
• Classification
  • Ankyrin repeat domain containing
  • Transient receptor potential cation channels
• VEGA ID
  OTTHUMG00000157157

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products