TRPV5 antibody

TRPV5 antibody is available 1 time from Fitzgerald labs

70R-5176 | TRPV5 antibodysize: 50 µg | 559.03 USD

Ajax processing
  • Category
    Primary Antibody
  • Antibody Subtype
    Polyclonal Antibodies, Purified
  • Area of research
    Signal Transduction
  • Type of Immunogen
    TRPV5 antibodies were raised using the N terminal of TRPV5 corresponding to a region with amino acids MLQQKRILESPLLRASKENDLSVLRQLLLDCTCDVRQRGALGETALHIAA
  • Raised in
    Rabbit
  • Specificity
    TRPV5 antibody was raised against the N terminal of TRPV5
  • Cross Reactivity
    Human
  • Method of Purification
    Affinity purified
  • Concentration
    1 mg/ml
  • Form & Buffer
    Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TRPV5 antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping conditions
    Blue Ice
  • Tested for
    WB
  • Usage Recommendations
    WB: 1 ug/ml
  • Assay Information
    TRPV5 Blocking Peptide, catalog no. 33R-6206, is also available for use as a blocking control in assays to test for specificity of this TRPV5 antibody
  • Additional Information
    This is a rabbit polyclonal antibody against TRPV5, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at antibodies@fitzgerald-fii.com
  • Applications
    WB
  • Product Type
    Primary Antibodies
  • Product Subtype
    Purified Polyclonal Antibodies
  • Research Area
    Signal Transduction
  • Immunogen
    TRPV5 antibody was raised using the N terminal of TRPV5 corresponding to a region with amino acids MLQQKRILESPLLRASKENDLSVLRQLLLDCTCDVRQRGALGETALHIAA
  • Shipping Info
    Blue Ice
  • Properties
    If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
    anticorps
  • Gene target
  • Short name
    TRPV5 antibody
  • Technique
    Antibody
  • Alternative name
    TRPV5 (Antibody to)
  • Alternative technique
    antibodies
Simillar products
Supplier:Cusabio
Price:197.72USD
Supplier:SAB
Price:504.89USD
Supplier:boster
Price:440.16USD
Supplier:Elabscience
Price:127.06USD
Supplier:SAB
Price:504.89USD
Supplier:NJS poly
Price:234.20USD
Supplier:abbex
Price:116.51USD
Supplier:genways
Price:613.16USD
Supplier:MyBioSource
Price:390.73USD
Supplier:Cygnus Technologies
Price:455.46USD
Supplier:Zyagen
Price:240.09USD
Supplier:ABM microrna
Price:331.89USD
Supplier:acr
Price:690.84USD
Supplier:aviva
Price:194.19USD
Supplier:ABM CrispR
Price:6 850.73USD
Supplier:MBS Recombinant
Price:2 243.17USD
Filters
+32-(0)1-658-90-45 lieven@gentaur.com
TRPV5 antibody from fitzgerald - Gentaur.com
Contact
Chat with gentaur.com employee