TRPV5 antibody

1x TRPV5 antibody found in fitzgerald

  • Category
    Primary Antibody
  • Antibody Subtype
    Polyclonal Antibodies, Purified
  • Area of research
    Signal Transduction
  • Type of Immunogen
    TRPV5 antibodies were raised using the N terminal of TRPV5 corresponding to a region with amino acids MLQQKRILESPLLRASKENDLSVLRQLLLDCTCDVRQRGALGETALHIAA
  • Raised in
    Rabbit
  • Specificity
    TRPV5 antibody was raised against the N terminal of TRPV5
  • Cross Reactivity
    Human
  • Method of Purification
    Affinity purified
  • Concentration
    1 mg/ml
  • Form & Buffer
    Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TRPV5 antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping conditions
    Blue Ice
  • Tested for
    WB
  • Usage Recommendations
    WB: 1 ug/ml
  • Assay Information
    TRPV5 Blocking Peptide, catalog no. 33R-6206, is also available for use as a blocking control in assays to test for specificity of this TRPV5 antibody
  • Additional Information
    This is a rabbit polyclonal antibody against TRPV5, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at antibodies@fitzgerald-fii.com
  • Gene target
  • Short name
    TRPV5 antibody
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Alternative name
    TRPV5 (Antibody to)
  • Alternative technique
    antibodies

70R-5176 | TRPV5 antibody50 µg 583.16 USD

Ajax processing
Simillar products
Supplier:MBS Polyclonals
Price:780.82USD
Supplier:ABM microrna
Price:2 671.48USD
Supplier:Epigen
Price:394.09USD
Supplier:aviva
Price:381.81USD
Supplier:MBS Recombinant
Price:2 503.28USD
Supplier:genways
Price:639.63USD
Supplier:proscience
Price:220.99USD
Supplier:Bioss Primary Conjugated Antibodies. ALEXA FLUOR
Price:408.52USD
Supplier:Molekula
Price:153.46USD
Supplier:ABM microrna
Price:1 598.47USD
Supplier:ABM microrna
Price:206.25USD
Supplier:aviva
Price:284.83USD
Supplier:abbex
Price:729.25USD
Supplier:consort
Price:307.29USD
Supplier:Elabscience
Price:132.54USD
Filters
+32-(0)1-658-90-45 lieven@gentaur.com
TRPV5 antibody - Gentaur.com
Contact
Chat with gentaur.com employee