TRPV5 antibody

TRPV5 antibody is available 2 times from Fitzgerald labs

70R-5176 | TRPV5 antibodysize: 50 µg | 547.87 USD

Ajax processing

70R-5176 | TRPV5 antibodysize: 50 ug | 570.93 USD

Ajax processing
  • Category
    Primary Antibody
  • Antibody Subtype
    Polyclonal Antibodies, Purified
  • Area of research
    Signal Transduction
  • Type of Immunogen
    TRPV5 antibodies were raised using the N terminal of TRPV5 corresponding to a region with amino acids MLQQKRILESPLLRASKENDLSVLRQLLLDCTCDVRQRGALGETALHIAA
  • Raised in
    Rabbit
  • Specificity
    TRPV5 antibody was raised against the N terminal of TRPV5
  • Cross Reactivity
    Human
  • Method of Purification
    Affinity purified
  • Concentration
    1 mg/ml
  • Form & Buffer
    Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TRPV5 antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping conditions
    Blue Ice
  • Tested for
    WB
  • Usage Recommendations
    WB: 1 ug/ml
  • Assay Information
    TRPV5 Blocking Peptide, catalog no. 33R-6206, is also available for use as a blocking control in assays to test for specificity of this TRPV5 antibody
  • Additional Information
    This is a rabbit polyclonal antibody against TRPV5, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at antibodies@fitzgerald-fii.com
  • Applications
    WB
  • Product Type
    Primary Antibodies
  • Product Subtype
    Purified Polyclonal Antibodies
  • Research Area
    Signal Transduction
  • Immunogen
    TRPV5 antibody was raised using the N terminal of TRPV5 corresponding to a region with amino acids MLQQKRILESPLLRASKENDLSVLRQLLLDCTCDVRQRGALGETALHIAA
  • Shipping Info
    Blue Ice
  • Properties
    If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
    anticorps
  • Gene target
  • Short name
    TRPV5 antibody
  • Technique
    Antibody
  • Alternative name
    TRPV5 (Antibody to)
  • Alternative technique
    antibodies
Simillar products
Supplier:Cusabio
Price:193.77USD
Supplier:Elabscience
Price:124.52USD
Supplier:boster
Price:431.37USD
Supplier:abbex
Price:114.19USD
Supplier:NJS poly
Price:229.53USD
Supplier:genways
Price:600.92USD
Supplier:QED Biosciences
Price:490.83USD
Supplier:MBS Recombinant
Price:1 650.52USD
Supplier:MBS Polyclonals
Price:426.76USD
Supplier:ABclonal
Price:267.59USD
Supplier:trca
Price:309.11USD
Supplier:MyBioSource
Price:0.00USD
Supplier:ABM CrispR
Price:6 713.94USD
Supplier:BioChain
Price:313.72USD
Supplier:trca
Price:141.87USD
Filters
+32-(0)1-658-90-45 lieven@gentaur.com
TRPV5 antibody - Gentaur.com
Contact
Chat with gentaur.com employee