SMAD1 Antibody

  • Catalog number
    PB9395
  • Price
    Please ask
  • Size
    0,1 mg
  • Target antigen
    SMAD1
  • Clonality
    Polyclonal antibody
  • Clone
    Polyclonal antibody
  • Raised in
    rabbit
  • Type of the antibody
    IgG polyclonal antibody
  • Product form
    freeze-dried
  • Reacts with species
    human, mouse, rat
  • Analyses
    WB
  • Immunogen
    A synthetic peptide corresponding to a sequence in the middle region of human SMAD1 (240-270aa QPMDTNMMAPPLPSEINRGDVQAVAYEEPKH), different from the related mouse sequence by two amino acids, and from the related rat sequence by five amino acids.
  • Product configuration
    Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
  • Purification
    Immunogen affinity purified.
  • Solubilization
    The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
  • Storage condtions
    Keep the SMAD1 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
  • Tips
    The SMAD1 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
  • Background
    SMADs are proteins that modulate the activity of transforming growth factor beta ligands. The SMADs, often in complex with other SMADs/CoSMAD, act as transcription factors that regulate the expression of certain genes. It was concluded that targeted ubiquitination of SMADs may serve to control both embryonic development and a wide variety of cellular responses to TGF-beta signals. R-Smads or receptor regulated Smads are a class of proteins that include SMAD1, SMAD2, SMAD3, SMAD5, and SMAD8. In response to signals by the TGF-β superfamily of ligands these proteins associate with receptor kinases and are phosphorylated at an SSXS motif at their extreme C-terminus. These proteins then typically bind to the common mediator Smad or co-SMAD SMAD4.
  • Related articles
    1. Zhu, H., Kavsak, P., Abdollah, S., Wrana, J. L., Thomsen, G. H. A SMAD ubiquitin ligase targets the BMP pathway and affects embryonic pattern formation. Nature 400: 687-693, 1999.
  • Gene Name
    SMAD1
  • Protein Name
    Mothers against decapentaplegic homolog 1
  • Gene Full Name
    SMAD family member 1
  • Synonyms
    BSP 1 | BSP1 | BSP-1 | BSP1 | MADH1 | MADR1 | HsMAD1 | JV4 1 | JV4-1 | MADH1 | Madh1 | Madr1 | Q15797 | SMAD1
  • Uniprot ID
    Q15797
  • Entrez GeneID
    4086
  • Properties
    If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
    anticorps
  • Gene target
    SMAD1  
  • Gene symbol
    SMAD1-AS2, SMAD1-AS1, SMAD1, GARS1
  • Short name
    SMAD1 Antibody
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Alternative name
    SMAD family member 1 (antibody to-)
  • Alternative technique
    antibodies
  • Alternative to gene target
    SMAD family member 1, BSP-1 and BSP1 and JV4-1 and JV41 and MADH1 and MADR1, SMAD1 and IDBG-39936 and ENSG00000170365 and 4086, transforming growth factor beta receptor, nuclei, Smad1 and IDBG-170516 and ENSMUSG00000031681 and 17125, SMAD1 and IDBG-629431 and ENSBTAG00000002835 and 540488
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    SMAD family member 1
  • Synonyms gene
  • Synonyms gene name
    • MAD, mothers against decapentaplegic homolog 1 (Drosophila)
    • SMAD, mothers against DPP homolog 1 (Drosophila)
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1996-11-15
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • SMAD family
  • VEGA ID
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee