RRM2 Antibody
-
Catalog numberR32063
-
PricePlease ask
-
Size0.1mg
-
-
CategoryAntibody
-
Concentration0.5mg/ml if reconstituted with 0.2ml sterile DI water
-
FormAntigen affinity purified
-
ConjugationUnconjugated
-
ClonePolyclonal antibody
-
Recognised antigenRRM2
-
Host animalRabbit (Oryctolagus cuniculus)
-
ClonalityPolyclonal (rabbit origin)
-
Species reactivityHuman (Homo sapiens), Mouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
-
Tested applicationsWB, IHC-P
-
Recommended dilutionsWestern blot: 0.1-0.5ug/ml,IHC (Paraffin): 0.5-1ug/ml
-
NotesOptimal dilution of the RRM2 antibody should be determined by the researcher.
-
Intented useThis RRM2 antibodyis to be used only for research purposes and not for diagnostics..
-
UniprotP31350
-
PurityAntigen affinity
-
DescriptionRibonucleoside-diphosphate reductase subunit M2, also known as ribonucleotide reductase small subunit, is an enzyme that in humans is encoded by the RRM2 gene. It is mapped to 2p25-p24. This gene encodes one of two non-identical subunits for ribonucleotide reductase. This reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. Synthesis of the encoded protein (M2) is regulated in a cell-cycle dependent fashion. Transcription from this gene can initiate from alternative promoters, which results in two isoforms which differ in the lengths of their N-termini. Related pseudogenes have been identified on chromosomes 1 and X.
-
ImmunogenAmino acids MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENT of human RRM2 were used as the immunogen for the RRM2 antibody.
-
StorageAfter reconstitution, the RRM2 antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
-
LocalizationCytoplasmic, membrane
-
PropertiesIf you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolRRM2
-
Short nameAnti-RRM2
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
IsotypeRabbit IgG
-
Alternative nameAntibodies to RRM2
-
Alternative techniqueantibodies
-
Gene info
-
Identity
-
Gene
-
Long gene nameribonucleotide reductase regulatory subunit M2
-
Synonyms gene
-
Synonyms gene name
- ribonucleotide reductase M2 polypeptide
- chromosome 2 open reading frame 48
-
Synonyms
-
Locus
-
Discovery year2001-06-22
-
Entrez gene record
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data