Recombinant Rat Receptor Tyrosine-Protein Kinase ErbB-2/ErbB2/HER2 (C-6His)

• Catalog number
  CH03-500
• Price
  Please ask
• Size
  500 ug

• Description
  Recombinant Rat ErbB2 is produced by our E.coli expression system and the target gene encoding Ala67-Val323 is expressed with a 6His tag at the C-terminus.
• Species reactivity
  Rat
• Origin
  Escherichia coli
• Peptide sequence
  MANASLSFLQDIQEVQGYMLIAHNQVKRVPLQRLRIVRGTQLFEDKYALAVLDNRDPQDNVAASTPGRTPEGLRELQLRSLTEILKGGVLIRGNPQLCYQDMVLWKDVFRKNNQLAPVDIDTNRSRACPPCAPACKDNHCWGESPEDCQILTGTICTSGCARCKGRLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMHNPEGRYTFGASCVTTCPYNYLSTEVGSCTLVCPPNNQEVHHHHHH
• Estimated molecular weight
  29,3 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of 20mM Tris,150mM NaCl, 4M Urea, pH 8.0.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  P06494
• Other related products
• About
  Rats are used to make rat monoclonal anti mouse antibodies. There are less rat- than mouse clones however. Rats genes from rodents of the genus Rattus norvegicus are often studied in vivo as a model of human genes in Sprague-Dawley or Wistar rats.
• Latin name
  Rattus norvegicus
• Additional description
  The receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Receptor   Tyrosine-Protein   Kinase   ErbB-2/ErbB2/HER2   C-6His  
• Gene symbol
  ERBB2
• Short name
  Recombinant Receptor Tyrosine-Protein Kinase ErbB-2/ErbB2/HER2 (C-6His)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Host
  Rat
• Species
  Rat, Rats
• Alternative name
  Rat ErbB2/Her2/CD340(C-6His)
• Alternative technique
  rec
• Alternative to gene target
  v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian), CD340 and HER-2 and HER-2/neu and HER2 and MLN 19 and NEU and NGL and TKR1, ERBB2 and IDBG-46068 and ENSG00000141736 and 2064, transferase activity, nuclei, Erbb2 and IDBG-210591 and ENSMUSG00000062312 and 13866, ERBB2 and IDBG-639410 and ENSBTAG00000021798 and 505709

Gene info

• Identity
  HGNC:3430
• Gene
  ERBB2
• Long gene name
  erb-b2 receptor tyrosine kinase 2
• Synonyms gene
  • NGL
• Synonyms gene name
  • v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 2 (neuro/glioblastoma derived oncogene homolog)
  • v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 2
• Synonyms
  • NEU
  • HER-2
  • CD340
  • HER2
• Synonyms name
  • neuro/glioblastoma derived oncogene homolog
  • human epidermal growth factor receptor 2
• GenBank acession
  • X03363
• Locus
  17q12
• Discovery year
  2001-06-22
• Entrez gene record
  2064
• RefSeq identity
  • NM_004448
• Classification
  • Erb-b2 receptor tyrosine kinases
  • CD molecules
  • Minor histocompatibility antigens
  • MicroRNA protein coding host genes
• VEGA ID
  OTTHUMG00000179300
• Locus Specific Databases
  • LRG_724

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products