Recombinant Mouse HVEM/TNFRSF14/TR2/CD270 (C-Fc)

  • Catalog number
    CJ90-500
  • Price
    Please ask
  • Size
    500 ug
  • Description
    Recombinant Mouse Herpesvirus Entry Mediator is produced by our Mammalian expression system and the target gene encoding Gln39-Val207 is expressed with a Fc tag at the C-terminus.
  • Species reactivity
    Mouse
  • Origin
    Human cells
  • Peptide sequence
    GYHVKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTVCRCIPGYFCENQDGSHCSTCLQHTTCPPGQRVEKRGTHDQDTVCADCLTGTFSLGGTQEECLPWTNCSAFQQEVRRGTNSTDTTCSSQVVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
  • Estimated molecular weight
    45,6 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    See included datasheet or contact us for more information.
  • UniProt number
    Q80WM9
  • Test
    Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
  • Latin name
    Mus musculus
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    TNFRSF14, NR2C1, TNFRSF14-AS1, TAS1R2, TNFSF14, TXNRD3
  • Short name
    Recombinant Mouse HVEM/TNFRSF14/TR2/CD270 (C-Fc)
  • Technique
    Recombinant, Mouse, FC, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Host
    mouse
  • Species
    Mouse, Mouses
  • Alternative name
    Mouse HVEM/TNFRSF14/TR2/CD270(C-Fc)
  • Alternative technique
    rec, murine
  • Alternative to gene target
    tumor necrosis factor receptor superfamily, member 14, ATAR and CD270 and HVEA and HVEM and LIGHTR and TR2, TNFRSF14 and IDBG-86399 and ENSG00000157873 and 8764, ubiquitin protein ligase binding, Cell surfaces, Tnfrsf14 and IDBG-207237 and ENSMUSG00000042333 and 230979
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    nuclear receptor subfamily 2 group C member 1
  • Synonyms gene
  • Synonyms gene name
    • nuclear receptor subfamily 2, group C, member 1
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1998-05-15
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • Nuclear receptor subfamily 2 group C
  • VEGA ID
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    taste 1 receptor member 2
  • Synonyms gene
  • Synonyms gene name
    • G protein-coupled receptor 71
    • taste receptor, type 1, member 2
  • Synonyms
  • Locus
  • Discovery year
    2001-03-21
  • Entrez gene record
  • Classification
    • Taste 1 receptors
  • VEGA ID
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee