Recombinant Human VAMPB/VAPB (C-6His)

• Catalog number
  C778-10
• Price
  Please ask
• Size
  10 ug

• Description
  Recombinant Human VAMPB is produced by our E.coli expression system and the target gene encoding Ala2-Pro132 is expressed with a 6His tag at the C-terminus.
• Species reactivity
  Human
• Origin
  Escherichia coli
• Peptide sequence
  MAKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKPLEHHHHHH
• Estimated molecular weight
  16 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of PBS,pH7.4.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  O95292
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  VAMPB/VAPB   C-6His  
• Gene symbol
  VAPB
• Short name
  Recombinant VAMPB/VAPB (C-6His)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Human VAMPB/VAPB(C-6His)
• Alternative technique
  rec

Gene info

• Identity
  HGNC:12649
• Gene
  VAPB
• Long gene name
  VAMP associated protein B and C
• Synonyms gene name
  • VAMP (vesicle-associated membrane protein)-associated protein B and C
• Synonyms
  • VAP-B
  • VAP-C
  • ALS8
• GenBank acession
  • AF086628
• Locus
  20q13.32
• Discovery year
  1999-03-19
• Entrez gene record
  9217
• Pubmed identfication
  • 9920726
• VEGA ID
  OTTHUMG00000032840
• Locus Specific Databases
  • ALSOD, the Amyotrophic Lateral Sclerosis Online Genetic Database
  • LRG_656

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products