Recombinant Human Ubiquitin-like-conjugating Enzyme ATG3/ATG3

• Catalog number
  CE30-50
• Price
  Please ask
• Size
  50 ug

• Description
  Recombinant Human Ubiquitin-like-conjugating Enzyme ATG3 is produced by our E.coli expression system and the target gene encoding Met1-Met314 is expressed.
• Species reactivity
  Human
• Origin
  Escherichia coli
• Peptide sequence
  GSMQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCSALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVEACKAKTDAGGEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHMYLLIFLKFVQAVIPTIEYDYTRHFTM
• Estimated molecular weight
  36 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Dry ice/ice packs
• Package form
  Supplied as a 0.2 µm filtered solution of 20mM TrisHCl,150mM NaCl,10% Glycerol,pH 8.0.
• Storage conditions
  Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
• Reconstitution conditions
  See included datasheet or contact us for more information.
• UniProt number
  Q9NT62
• Other related products
• Additional description
  Enzymes are cleaving the substrate. If the substrate is DNA they are called restriction enzymes. Activating enzymes will cut off the domain that is biological active to become functional.
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Ubiquitin-like-conjugating   ATG3/ATG3  
• Gene symbol
  ATG3
• Short name
  Recombinant Ubiquitin-like-conjugating Enzyme ATG3/ATG3
• Technique
  Recombinant, Enzyme, enzymes, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Recombinant Human ATG3
• Alternative technique
  rec, enzymes
• Alternative to gene target
  autophagy related 3, ATG3 and IDBG-49891 and ENSG00000144848 and 64422, enzyme binding, Cytoplasm, Atg3 and IDBG-162821 and ENSMUSG00000022663 and 67841, ATG3 and IDBG-632300 and ENSBTAG00000009084 and 508571

Gene info

• Identity
  HGNC:20962
• Gene
  ATG3
• Long gene name
  autophagy related 3
• Synonyms gene
  • APG3L
• Synonyms gene name
  • APG3 autophagy 3-like (S. cerevisiae)
  • ATG3 autophagy related 3 homolog (S. cerevisiae)
• Synonyms
  • PC3-96
  • FLJ22125
  • MGC15201
  • DKFZp564M1178
• Locus
  3q13.2
• Discovery year
  2004-07-05
• Entrez gene record
  64422
• Pubmed identfication
  • 11825910
• RefSeq identity
  • NM_022488
• Classification
  • Autophagy related
• VEGA ID
  OTTHUMG00000159260

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products