Recombinant Human Ubiquitin/ISG15-Conjugating Enzyme E2 L6/UBE2L6//UbcH8 (C-6His)

• Catalog number
  CG31-50
• Price
  Please ask
• Size
  50 ug

• Description
  Recombinant Human Ubiquitin-Conjugating Enzyme E2 L6 is produced by our E.coli expression system and the target gene encoding Met1-Ser153 is expressed with a 6His tag at the C-terminus.
• Species reactivity
  Human
• Origin
  Escherichia coli
• Peptide sequence
  MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPSLEHHHHHH
• Estimated molecular weight
  18,8 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Dry Ice/ice packs
• Package form
  Supplied as a 0.2 µm filtered solution of 50mM HEPES, 100mM NaCl, pH 8.0.
• Storage conditions
  Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  O14933
• Other related products
• Additional description
  Enzymes are cleaving the substrate. If the substrate is DNA they are called restriction enzymes. Activating enzymes will cut off the domain that is biological active to become functional.
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Ubiquitin/ISG15-Conjugating   L6/UBE2L6//UbcH8   C-6His  
• Gene symbol
  ISG15, UBE2L6
• Short name
  Recombinant Ubiquitin/ISG15-Conjugating Enzyme E2 L6/UBE2L6//UbcH8 (C-6His)
• Technique
  Recombinant, Enzyme, enzymes, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Human UBE2L6/UbcH8(C-6His)
• Alternative technique
  rec, enzymes

Gene info

• Identity
  HGNC:4053
• Gene
  ISG15
• Long gene name
  ISG15 ubiquitin like modifier
• Synonyms gene
  • G1P2
• Synonyms gene name
  • interferon, alpha-inducible protein (clone IFI-15K)
• Synonyms
  • IFI15
  • UCRP
• GenBank acession
  • BC009507
• Locus
  1p36.33
• Discovery year
  1990-10-16
• Entrez gene record
  9636
• Pubmed identfication
  • 3087979
• RefSeq identity
  • NM_005101
• VEGA ID
  OTTHUMG00000040777
• Locus Specific Databases
  • LRG_1231

Gene info

• Identity
  HGNC:12490
• Gene
  UBE2L6
• Long gene name
  ubiquitin conjugating enzyme E2 L6
• Synonyms gene name
  • ubiquitin-conjugating enzyme E2L 6
• Synonyms
  • UBCH8
• GenBank acession
  • AF031141
  • AK093462
  • BC032491
• Locus
  11q12.1
• Discovery year
  1999-02-26
• Entrez gene record
  9246
• Pubmed identfication
  • 9153201
• RefSeq identity
  • NM_004223
• Classification
  • Ubiquitin conjugating enzymes E2
• VEGA ID
  OTTHUMG00000167047

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products