Recombinant Human Ubiquitin-Conjugating Enzyme E2 Z/UBE2Z (N-6His)
-
Catalog number
CG35-500
-
Price
Please ask
-
Size
500 ug
-
-
Description
Recombinant Human Ubiquitin-Conjugating Enzyme E2 Z is produced by our E.coli expression system and the target gene encoding Met1-Val246 is expressed with a 6His tag at the N-terminus.
-
Species reactivity
Human
-
Origin
Escherichia coli
-
Peptide sequence
MGSSHHHHHHSSGLVPRGSHMSIYKEPPPGMFVVPDTVDMTKIHALITGPFDTPYEGGFFLFVFRCPPDYPIHPPRVKLMTTGNNTVRFNPNFYRNGKVCLSILGTWTGPAWSPAQSISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDPFGEKRGHFDYQSLLMRLGLIRQKVLERLHNENAEMDSDSSSSGTETDLHGSLRV
-
Estimated molecular weight
30,2 kDa
-
Protein purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Endotoxin level
Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
-
Shipping condition
Dry Ice/ice packs
-
Package form
Supplied as a 0.2 µm filtered solution of 50mM HEPES, 50mM NaCl, pH 8.0.
-
Storage conditions
Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
-
Reconstitution conditions
See included datasheet or contact us for more information.
-
UniProt number
Q9H832-2
-
-
Additional description
Enzymes are cleaving the substrate. If the substrate is DNA they are called restriction enzymes. Activating enzymes will cut off the domain that is biological active to become functional.
-
Properties
Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
-
Source
Recombinants or rec. proteins
-
Group
recombinants
-
Gene target
-
Gene symbol
UBE2Z
-
Short name
Recombinant Ubiquitin-Conjugating Enzyme E2 Z/UBE2Z (N-6His)
-
Technique
Recombinant, Enzyme, enzymes, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
-
Species
Human, Humans
-
Alternative name
Human UBE2Z/Use1(N-6His)
-
Alternative technique
rec, enzymes
-
Alternative to gene target
ubiquitin-conjugating enzyme E2Z, UBE2Z and IDBG-57321 and ENSG00000159202 and 65264, acid-amino acid ligase activity, nuclei, Ube2z and IDBG-209805 and ENSMUSG00000014349 and 268470, LOC100138178 and IDBG-638867 and ENSBTAG00000018802 and 100138178
-
Gene info
MeSH Data
-
Name
-
Concept
Scope note:
The initial culturing of cells derived directly from fresh TISSUES.
-
Tree numbers
- E01.370.225.500.223.500
- E05.200.500.265.500
- E05.242.223.500
- E05.481.500.249.500
-
Qualifiers
ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products