Recombinant Human Ubiquitin-Conjugating Enzyme E2 Variant 1/UBE2V1 (C-6His)

  • Catalog number
    CG36-10
  • Price
    Please ask
  • Size
    10 ug
  • Description
    Recombinant Human Ubiquitin-Conjugating Enzyme E2 Variant 1 is produced by our E.coli expression system and the target gene encoding Ala2-Asn147 is expressed with a 6His tag at the C-terminus.
  • Species reactivity
    Human
  • Origin
    Escherichia coli
  • Peptide sequence
    AATTGSGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQCYSNLEHHHHHH
  • Estimated molecular weight
    17,5 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Dry Ice/ice packs
  • Package form
    Supplied as a 0.2 µm filtered solution of 50mM HEPES, 100mM NaCl, pH 8.0.
  • Storage conditions
    Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
  • Reconstitution conditions
    See included datasheet or contact us for more information.
  • UniProt number
    Q13404
  • Additional description
    Enzymes are cleaving the substrate. If the substrate is DNA they are called restriction enzymes. Activating enzymes will cut off the domain that is biological active to become functional.
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    PEDS1-UBE2V1, UBE2V1
  • Short name
    Recombinant Ubiquitin-Conjugating Enzyme E2 Variant 1/UBE2V1 (C-6His)
  • Technique
    Recombinant, Enzyme, enzymes, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    Human UBE2V1/Uev1a(C-6His)
  • Alternative technique
    rec, enzymes
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Radioimmunoassay of proteins using antibody coupled to an immunosorbent.
  • Tree numbers
    • E05.478.566.380.830
    • E05.478.566.639.830
    • E05.601.470.380.830
    • E05.601.470.639.830
  • Qualifiers
    ethics, mortality, psychology, trends, veterinary, history, classification, economics, instrumentation, methods, nursing, standards, adverse effects, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee