Recombinant Human Thymic stromal lymphopoietin TSLP

Recombinant Human Thymic stromal lymphopoietin TSLP is available 3 times from Bioma labs

  • Other name
    no alternative name
  • Protein origin
    Mammalian cell
  • Estimated production time
    7-11 business days
  • Gene number
    TSLP
  • Expected molecular weight
    18.51kDa
  • Protein number
    Q969D9
  • Protein sequence
    YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
  • Notes
    For research use only. Not for diagnostic procedures.
  • Use before
    1 year
  • Information about sequence
    Full Length
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Shipping requirements
    Blue ice
  • Verified reactivity
    Homo sapiens (Human)
  • Protein purity
    ≥ 90%
  • Protein region
    29-159aa
  • Gene target
  • Short name
    Recombinant Thymic stromal lymphopoietin(TSLP)
  • Technique
    Recombinant
  • Species
    Human
  • Alternative name
    recombinant H. sapiens Thymic stromal lymphopoietin(thymic stromal lymphopoietin)
  • Alternative technique
    rec
  • Alternative to gene target
    thymic stromal lymphopoietin, TSLP and IDBG-36507 and ENSG00000145777 and 85480, this GO :0005125 and cytokine activity and molecular function this GO :0005615 and extracellular space and cellular component, cytokine activity, this GO :0005125: cytokine activity, this GO :0005125: cytokine activity, Extracellular, Tslp and IDBG-134008 and ENSMUSG00000024379 and 53603

RPC20590 | Recombinant Human Thymic stromal lymphopoietin(TSLP)size: 20 μg | 697.35 USD

  • Catalog number
    RPC20590
  • Supplier
  • Price
    697.35 USD
  • Size
    20 μg
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
0. Gene info
MeSH Data
  • Name
  • Concept
    Scope note:The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    classification, economics, history, instrumentation, methods, standards, trends, utilization, veterinary, statistics & numerical data, ethics
Additional information

RPC20590 | Recombinant Human Thymic stromal lymphopoietin(TSLP)size: 50 μg | 1226.21 USD

Ajax processing

RPC20590 | Recombinant Human Thymic stromal lymphopoietin(TSLP)size: 100 μg | 1544.75 USD

Ajax processing
Simillar products
Supplier:MBS Recombinant
Price:2 093.29USD
Supplier:ABM microrna
Price:2 676.26USD
Supplier:ABM microrna
Price:1 601.33USD
Supplier:ABM microrna
Price:1 601.33USD
Supplier:abbex
Price:730.56USD
Supplier:Genesee
Price:124.22USD
Supplier:Bluegen antibodies
Price:571.90USD
Supplier:MBS Polyclonals
Price:325.92USD
Supplier:MBS Recombinant
Price:1 956.77USD
Supplier:acr
Price:453.83USD
Supplier:MBS Recombinant
Price:1 937.09USD
Supplier:MBS Recombinant
Price:1 929.71USD
Supplier:ABM CrispR
Price:7 159.25USD
Supplier:aat
Price:163.15USD
Supplier:MBS Recombinant
Price:2 297.45USD
Supplier:creative enzymes
Price:332.56USD
Filters
+32-(0)1-658-90-45 lieven@gentaur.com
Recombinant Human Thymic stromal lymphopoietin T|gentaur.com
Contact
Chat with gentaur.com employee