Recombinant Human Resistin/RETN/ADSF (C-6His)

• Catalog number
  CG51-500
• Price
  Please ask
• Size
  500 ug

• Description
  Recombinant Human Resistin is produced by our E.coli expression system and the target gene encoding Lys19-Pro108 is expressed with a 6His tag at the C-terminus.
• Species reactivity
  Human
• Origin
  Escherichia coli
• Peptide sequence
  KTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQPLEHHHHHH
• Estimated molecular weight
  10,6 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of 20mM Acetic acid,pH 3.0.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  Q9HD89
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Resistin/RETN/ADSF   C-6His  
• Gene symbol
  RETN
• Short name
  Recombinant Resistin/RETN/ADSF (C-6His)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Human ADSF/Resistin(C-6His)
• Alternative technique
  rec
• Alternative to gene target
  resistin, RETN and IDBG-23228 and ENSG00000104918 and 56729, hormone activity, nuclei, Retn and IDBG-130350 and ENSMUSG00000012705 and 57264, RETN and IDBG-643684 and ENSBTAG00000004716 and 369020

Gene info

• Identity
  HGNC:20389
• Gene
  RETN
• Long gene name
  resistin
• Synonyms
  • FIZZ3
  • ADSF
  • RETN1
• GenBank acession
  • AF205952
• Locus
  19p13.2
• Discovery year
  2003-02-03
• Entrez gene record
  56729
• Pubmed identfication
  • 12050208
• RefSeq identity
  • NM_020415
• VEGA ID
  OTTHUMG00000182503

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products