Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase FKBP7/FKBP7 (C-6His)

• Catalog number
  CA33-50
• Price
  Please ask
• Size
  50 ug

• Description
  Recombinant Human PPIase FKBP7 is produced by our Mammalian expression system and the target gene encoding Gln24-Leu222 is expressed with a 6His tag at the C-terminus.
• Species reactivity
  Human
• Origin
  Human cells
• Peptide sequence
  QRQKKEESTEEVKIEVLHRPENCSKTSKKGDLLNAHYDGYLAKDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAMTDMCPGEKRKVVIPPSFAYGKEGYAEGKIPPDATLIFEIELYAVTKGPRSIETFKQIDMDNDRQLSKAEINLYLQREFEKDEKPRDKSYQDAVLEDIFKKNDHDGDGFISPKEYNVYQHDELVDHHHHHH
• Estimated molecular weight
  23,94 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Dry ice/ice packs
• Package form
  Supplied as a 0.2 µm filtered solution of 20mM TrisHCl,150mM NaCl,1mM GaCl2,10%Glycerol,pH7.5.
• Storage conditions
  Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  Q9Y680
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Peptidyl-Prolyl   Cis-Trans   Isomerase   FKBP7/FKBP7   C-6His  
• Gene symbol
  FKBP7
• Short name
  Recombinant Peptidyl-Prolyl Cis-Trans Isomerase FKBP7/FKBP7 (C-6His)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Human PPIase FKBP7/FKBP7(C-6His)
• Alternative technique
  rec
• Alternative to gene target
  FK506 binding protein 7, FKBP7 and IDBG-76052 and ENSG00000079150 and 51661, FK506 binding, Cytoplasm, Fkbp7 and IDBG-182182 and ENSMUSG00000002732 and 14231, FKBP7 and IDBG-640202 and ENSBTAG00000001097 and 509422

Gene info

• Identity
  HGNC:3723
• Gene
  FKBP7
• Long gene name
  FKBP prolyl isomerase 7
• Synonyms gene name
  • FK506-binding protein 7
  • FK506 binding protein 7
• Synonyms
  • FKBP23
• GenBank acession
  • AF092137
• Locus
  2q31.2
• Discovery year
  1998-12-09
• Entrez gene record
  51661
• Pubmed identfication
  • 9806833
• RefSeq identity
  • NM_181342
• Classification
  • EF-hand domain containing
  • FKBP prolyl isomerases
• VEGA ID
  OTTHUMG00000132577

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products