Recombinant Human N-myc Downstream Regulated Gene 1/NDRG1/DRG-1CAP43 (N-6His)
-
Catalog number
C299-500
-
Price
Please ask
-
Size
500 ug
-
-
Description
Recombinant Human NDRG1 is produced by our E.coli expression system and the target gene encoding Met1-Cys394 is expressed with a 6His tag at the N-terminus.
-
Species reactivity
Human
-
Origin
Escherichia coli
-
Peptide sequence
MGSSHHHHHHSSGLVPRGSHMSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGTRSRSHTSEGTRSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSC
-
Estimated molecular weight
45 kDa
-
Protein purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Endotoxin level
Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
-
Shipping condition
Ambient/Room Temperature
-
Package form
Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
-
Storage conditions
Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
-
Reconstitution conditions
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
-
UniProt number
Q92597
-
-
Additional description
cDNA genes are a locus (or region) of DNA for functional transcript RNA or protein. An ELISA is used to detect the expressed protein in biological fluids, serum, saliva.
-
Properties
Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
-
Source
Recombinants or rec. proteins
-
Group
recombinants
-
Gene target
-
Gene symbol
NDRG1
-
Short name
Recombinant N-myc Downstream Regulated 1/NDRG1/DRG-1CAP43 (N-6His)
-
Technique
Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
-
Species
Human, Humans
-
Alternative name
Human NDRG1/DRG-1CAP43(N-6His)
-
Alternative technique
rec
-
Alternative to gene target
v-myc myelocytomatosis viral oncogene homolog (avian), bHLHe39 and c-Myc and MRTL and MYCC, MYC and IDBG-35442 and ENSG00000136997 and 4609, E-box binding, nuclei, Bmyc and IDBG-147082 and ENSMUSG00000049086 and 107771, MYC and IDBG-644147 and ENSBTAG00000008409 and 511077
-
Gene info
MeSH Data
-
Name
-
Concept
Scope note:
The initial culturing of cells derived directly from fresh TISSUES.
-
Tree numbers
- E01.370.225.500.223.500
- E05.200.500.265.500
- E05.242.223.500
- E05.481.500.249.500
-
Qualifiers
ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
