Recombinant Human High affinity immunoglobulin epsilon receptor subunit alpha(FCER1A),partial

  • Catalog number
    RPC20352
  • Price
    Please ask
  • Size
    1 mg
  • Verified reactivity
    Homo sapiens (Human)
  • Protein number
    P12319
  • Gene number
    FCER1A
  • Other name
    c-epsilon RI-alpha; Short name:; FcERI; IgE Fc receptor subunit alpha
  • Protein origin
    E.coli
  • Protein region
    26-205aa
  • Protein sequence
    VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQ
  • Information about sequence
    Extracellular Domain
  • Expected molecular weight
    37.02kDa
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Test
    A high affinity purification column was use to purify Recombinant immunoglobulin epsilon receptor subunit alpha(FCER1A),partial by bioma by chromatographic size exclusion.
  • Description
    The Recombinant immunoglobulin epsilon receptor subunit alpha(FCER1A),partial is a α- or alpha protein sometimes glycoprotein present in blood. The receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    FCER1A
  • Short name
    Recombinant immunoglobulin epsilon receptor subunit alpha(FCER1A),partial
  • Technique
    Recombinant, affinity, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Label
    N-terminal 6xHis-SUMO-tagged
  • Species
    Human, Humans
  • Alternative name
    Rec. H. sapiens High protein immunoglobulin epsilon receptor functionnal sequence a(fragment c fragment on immunoglobuline E, high affinity I, receptor to measure; a polypeptide),partial
  • Alternative technique
    rec
  • Alternative to gene target
    Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide, FCE1A and FcERI, FCER1A and IDBG-103887 and ENSG00000179639 and 2205, IgE binding, Cell surfaces, Fcer1a and IDBG-205782 and ENSMUSG00000005339 and 14125, FCER1A and IDBG-630768 and ENSBTAG00000012887 and 506783
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee