Recombinant Human Granzyme A/GZMA (C-6His)

  • Catalog number
    C355-50
  • Price
    Please ask
  • Size
    50 ug
  • Description
    Recombinant Human Granzyme A is produced by our Mammalian expression system and the target gene encoding Glu27-Val262 is expressed with a 6His tag at the C-terminus.
  • Species reactivity
    Human
  • Origin
    Human cells
  • Peptide sequence
    EKIIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRSQVILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLTEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSCNGDSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKGAVVDHHHHHH
  • Estimated molecular weight
    27,11 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of 20mM MES, 150mM NaCl, pH 5.5.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • UniProt number
    P12544
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    GZMA
  • Short name
    Recombinant Granzyme A/GZMA (C-6His)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    Human Granzyme A/GZMA(C-6His)
  • Alternative technique
    rec
  • Alternative to gene target
    granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3), CTLA3 and HFSP, GZMA and IDBG-20850 and ENSG00000145649 and 3001, protein homodimerization activity, nuclei, Gzma and IDBG-183453 and ENSMUSG00000023132 and 14938, BT.58970 and IDBG-629315 and ENSBTAG00000021958 and 539093
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee