Recombinant Human ETS1/EWSR2/P54 (N-6His)

  • Catalog number
    CF51-500
  • Price
    Please ask
  • Size
    500 ug
  • Description
    Recombinant Human ETS1 is produced by our E.coli expression system and the target gene encoding Met1-Thr272 is expressed with a 6His tag at the N-terminus.
  • Species reactivity
    Human
  • Origin
    Escherichia coli
  • Peptide sequence
    MGSSHHHHHHSSGLVPRGSHMKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCGQEMGKEEKQT
  • Estimated molecular weight
    33 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl,1mM EDTA,pH7.4.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • UniProt number
    Q96AC5
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    ETS1, H3P43, FLI1, SRSF11, ETS1-AS1, DDX6, NONO, FKBP5
  • Short name
    Recombinant ETS1/EWSR2/P54 (N-6His)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    Human ETS1/EWSR2/p54(N-6His)
  • Alternative technique
    rec
  • Alternative to gene target
    v-ets erythroblastosis virus E26 oncogene homolog 1 (avian), ETS-1 and EWSR2 and p54, ETS1 and IDBG-75897 and ENSG00000134954 and 2113, sequence-specific DNA binding, nuclei, Ets1 and IDBG-147548 and ENSMUSG00000032035 and 23871, ETS1 and IDBG-642787 and ENSBTAG00000002341 and 540313
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    Fli-1 proto-oncogene, ETS transcription factor
  • Synonyms gene name
    • Friend leukemia virus integration 1
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1991-06-05
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • ETS transcription factor family
  • VEGA ID
  • Locus Specific Databases
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    DEAD-box helicase 6
  • Synonyms gene
  • Synonyms gene name
    • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 6 (RNA helicase, 54kD)
    • DEAD (Asp-Glu-Ala-Asp) box polypeptide 6
    • DEAD (Asp-Glu-Ala-Asp) box helicase 6
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1992-09-14
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • DEAD-box helicases
  • VEGA ID
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    FKBP prolyl isomerase 5
  • Synonyms gene name
    • FK506-binding protein 5
    • FK506 binding protein 5
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1997-06-09
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Tetratricopeptide repeat domain containing
    • FKBP prolyl isomerases
    • MicroRNA protein coding host genes
  • VEGA ID
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee