Recombinant Human Cyclophilin C/PPIase C/PPIC (N-Trx, 6His)

• Catalog number
  C215-500
• Price
  Please ask
• Size
  500 ug

• Description
  Recombinant Human Cyclophilin C is produced by our E.coli expression system and the target gene encoding Lys31-Asp182 is expressed with a Trx, 6His tag at the N-terminus.
• Species reactivity
  Human
• Origin
  Escherichia coli
• Peptide sequence
  MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMAKRGPSVTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGEKGYGYKGSKFHRVIKDFMIQGGDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVIDGMTVVHSIELQATD
• Estimated molecular weight
  33,78 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Dry ice/ice packs
• Package form
  Supplied as a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, 10% Glycerol, pH 7.4.
• Storage conditions
  Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  P45877
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Cyclophilin   C/PPIase   C/PPIC   N-Trx   6His  
• Gene symbol
  PPIC, PPIC-AS1
• Short name
  Recombinant Cyclophilin C/PPIase C/PPIC (N-Trx, 6His)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Human Cyclophilin C/PPIase C/PPIC(N-Trx, 6His)
• Alternative technique
  rec
• Alternative to gene target
  peptidylprolyl isomerase C (cyclophilin C), CYPC, PPIC and IDBG-39025 and ENSG00000168938 and 5480, unfolded protein binding, Cytoplasm, Ppic and IDBG-147010 and ENSMUSG00000024538 and 19038, PPIC and IDBG-644954 and ENSBTAG00000001568 and 535494

Gene info

• Identity
  HGNC:9256
• Gene
  PPIC
• Long gene name
  peptidylprolyl isomerase C
• Synonyms
  • CYPC
• Synonyms name
  • cyclophilin C
• GenBank acession
  • S71018
• Locus
  5q23.2
• Discovery year
  1993-06-18
• Entrez gene record
  5480
• Pubmed identfication
  • 1383094
  • 8031755
• RefSeq identity
  • NM_000943
• Classification
  • Cyclophilin peptidylprolyl isomerases
• VEGA ID
  OTTHUMG00000128921

Gene info

• Identity
  HGNC:40464
• Gene
  PPIC-AS1
• Long gene name
  PPIC antisense RNA 1
• Locus
  5q23.2
• Discovery year
  2019-09-19
• Entrez gene record
  107986447
• Classification
  • Antisense RNAs

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products