Recombinant Human 14-3-3 Protein e/YWHAE (N-GST)

  • Catalog number
    CE07-1000
  • Price
    Please ask
  • Size
    1 mg
  • Description
    Recombinant Human 14-3-3 Protein epsilon is produced by our E.coli expression system and the target gene encoding Met1-Gln255 is expressed with a GST tag at the N-terminus.
  • Species reactivity
    Human
  • Origin
    Escherichia coli
  • Peptide sequence
    MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSPEFHMDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ
  • Estimated molecular weight
    56 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • UniProt number
    P62258
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
    14-3-3   Protein   e/YWHAE   N-GST  
  • Gene symbol
    YWHAQ, YWHAG, YWHAZ, MIR1302-3, MIR509-3, MIR7-3, PIRC14, PIRC12
  • Short name
    Recombinant 14-3-3 Protein e/YWHAE (N-GST)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    Human 14-3-3 protein epsilon/YWHAE(N-GST)
  • Alternative technique
    rec
  • Alternative to gene target
    tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide, 14-3-3E and HEL2 and KCIP-1 and MDCR and MDS, YWHAE and IDBG-14629 and ENSG00000108953 and 7531, phosphoprotein binding, Plasma membranes, Ywhae and IDBG-200597 and ENSMUSG00000020849 and 22627, YWHAE and IDBG-632682 and ENSBTAG00000005664 and 282125
Gene info
  • Identity
  • Gene
  • Long gene name
    tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta
  • Synonyms gene name
    • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide
    • protein, theta
  • Synonyms
  • Synonyms name
  • GenBank acession
  • Locus
  • Discovery year
    1999-08-20
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • 14-3-3 phospho-serine/phospho-threonine binding proteins
  • VEGA ID
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta
  • Synonyms gene
  • Synonyms gene name
    • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, delta polypeptide
    • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide
  • Synonyms
  • Synonyms name
  • GenBank acession
  • Locus
  • Discovery year
    1993-09-20
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • 14-3-3 phospho-serine/phospho-threonine binding proteins
  • VEGA ID
Gene info
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    piwi-interacting RNA cluster 14
  • Locus
    3
  • Discovery year
    2009-11-05
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Piwi-interacting RNA clusters
Gene info
  • Identity
  • Gene
  • Long gene name
    piwi-interacting RNA cluster 12
  • Locus
    3
  • Discovery year
    2009-11-05
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Piwi-interacting RNA clusters
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee