Recombinant Carassius Auratus Leptin (N-8His)

• Catalog number
  CM20-10
• Price
  Please ask
• Size
  10 ug

• Description
  Recombinant Carassiusauratus Leptin is produced by our Yeast expression system and the target gene encoding Pro22-Cys171 is expressed with a 8His tag at the N-terminus.
• Species reactivity
  Human
• Origin
  Escherichia coli
• Peptide sequence
  HHHHHHHHPVHPDRLKNMVKLQADTIILRIKDHNEKLKLYPKLLIGDPELYPEVPADRHIQGLGSIMDTLTIFQKVLQRLPKGHVSQIRSDLSTLLGYLKERTTSMHCILKEPANGRSLDAFLEENATHHITLGYLALDRLKQFMQKLIVNLDQLKSC
• Estimated molecular weight
  18,3 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of PBS,pH7.4.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  B8YI02
• Other related products
• Gene
  Human or mouse Leptin (from Greek λεπτός leptos, "thin") the "satiety hormone", is a hormone made by adipose cells that helps to regulate energy balance by inhibiting hunger. Leptin is opposed by the actions of the hormone ghrelin, the "hunger hormone". Both hormones act on receptors in the arcuate nucleus of the hypothalamus to regulate appetite to achieve energy homeostasis. ELISA kits and peptides and antibodies are available.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Carassius   Auratus   Leptin   N-8His  
• Short name
  Recombinant Carassius Auratus Leptin (N-8His)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Alternative name
  Carassiusauratus Leptin(N-8His)
• Alternative technique
  rec

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products