Recombinant Candida glabrata Serine/threonine-protein kinase ATG1(ATG1)

#
  • Catalog number
    RPC20158
  • Price:

    Please ask

    Ask for price
  • Size
    100 μg
# #
  • Verified reactivity
    Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
  • Protein number
    Q6FL58 
  • Gene number
    ATG1
  • Other name
    Autophagy-related protein 1
  • Protein origin
    E.coli
  • Protein region
    11-312aa
  • Protein sequence
    YVVEKEIGKGSFATVYRGHVTTDPKSHIAVKAVARSKLKNKKLLENLEIEIAILKKIKHPHIVGLIDCERTTTDFYLVMDYCALGDLTFLIKKRKELENNHPLLQTVFNKYPPPSKEHNGLNRAFVVCYLQQLASALKFLRSKNLVHRDIKPQNLLLATPLTNYRDSKTFHELGYVGIYNLPILKIADFGFARFLPSTSLAETLCGSPLYMAPEILNYQKYNAKADLWSVGTVLFEMCCGVPPFTASNHLELFKKIKRAHDEINFPEVCEVEDGLKELICSLLTFDPAKRIGFEEFFNNKIV
  • Information about sequence
    Full Length
  • Expected molecular weight
    38.49kDa
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Description
    Serine protease, D- or L-serine arginine rich enzyme of serine threonine kinase with serine that is encoded by the codons UCU, UCC, UCA, UCG, AGU and AGC is an ɑ-amino acid that is used in the biosynthesis of proteins. It contains an α-amino group (which is in the protonated −NH+ 3 form under biological conditions), a carboxyl group. It is non-essential in humans, meaning the body can synthesize it.
#
  • Gene target
  • Gene symbol
    ULK1
  • Short name
    Recombinant Candida glabrata Serine/threonine-protein kinase ATG1(ATG1)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Label
    N-terminal 6xHis-tagged
  • Alternative name
    Rec. Candida glabrata Serine/threonine-protein phosphorylation catalyst ATG1(ATG1)
  • Alternative technique
    rec
  • Disease
    candida
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee