PTPN22 Antibody

• Catalog number
  R32361
• Price
  Please ask
• Size
  0.1mg

• Category
  Antibody
• Concentration
  0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Form
  Antigen affinity purified
• Conjugation
  Unconjugated
• Clone
  Polyclonal antibody
• Recognised antigen
  PTPN22
• Host animal
  Rabbit (Oryctolagus cuniculus)
• Clonality
  Polyclonal (rabbit origin)
• Species reactivity
  Human (Homo sapiens), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
• Tested applications
  WB
• Recommended dilutions
  Western blot: 0.1-0.5ug/ml
• Notes
  Optimal dilution of the PTPN22 antibody should be determined by the researcher.
• Intented use
  This PTPN22 antibodyis to be used only for research purposes and not for diagnostics..
• Uniprot
  Q9Y2R2
• Purity
  Antigen affinity
• Description
  Protein tyrosine phosphatase, non-receptor type 22 (lymphoid), also known as PTPN22, is a protein that in humans is encoded by the PTPN22 gene. This gene encodes of member of the non-receptor class 4 subfamily of the protein-tyrosine phosphatase family. The encoded protein is a lymphoid-specific intracellular phosphatase that associates with the molecular adapter protein CBL and may be involved in regulating CBL function in the T-cell receptor signaling pathway. Mutations in this gene may be associated with a range of autoimmune disorders including Type 1 Diabetes, rheumatoid arthritis, systemic lupus erythematosus and Graves' disease. Alternatively spliced transcript variants encoding distinct isoforms have been described.
• Immunogen
  Amino acids MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADK of human PTPN22 were used as the immunogen for the PTPN22 antibody.
• Storage
  After reconstitution, the PTPN22 antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
• Properties
  If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  PTPN22  
• Gene symbol
  PTPN22
• Short name
  Anti-PTPN22
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Isotype
  Rabbit IgG
• Alternative name
  Antibodies to PTPN22
• Alternative technique
  antibodies
• Alternative to gene target
  protein tyrosine phosphatase, non-receptor type 22 (lymphoid), PTPN22 and IDBG-101222 and ENSG00000134242 and 26191, kinase binding, nuclei, Ptpn22 and IDBG-181952 and ENSMUSG00000027843 and 19260, PTPN22 and IDBG-634891 and ENSBTAG00000019617 and

Gene info

• Identity
  HGNC:9652
• Gene
  PTPN22
• Long gene name
  protein tyrosine phosphatase non-receptor type 22
• Synonyms gene
  • PTPN8
• Synonyms gene name
  • protein tyrosine phosphatase, non-receptor type 8
  • protein tyrosine phosphatase, non-receptor type 22 (lymphoid)
• Synonyms
  • Lyp
  • Lyp1
  • Lyp2
• GenBank acession
  • AF001846
• Locus
  1p13.2
• Discovery year
  1999-11-26
• Entrez gene record
  26191
• Pubmed identfication
  • 10068674
  • 1373816
• RefSeq identity
  • NM_015967
• Classification
  • Protein tyrosine phosphatases non-receptor type
• VEGA ID
  OTTHUMG00000011936

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products