PTPN22 Antibody
-
Catalog numberR32361
-
PricePlease ask
-
Size0.1mg
-
-
CategoryAntibody
-
Concentration0.5mg/ml if reconstituted with 0.2ml sterile DI water
-
FormAntigen affinity purified
-
ConjugationUnconjugated
-
ClonePolyclonal antibody
-
Recognised antigenPTPN22
-
Host animalRabbit (Oryctolagus cuniculus)
-
ClonalityPolyclonal (rabbit origin)
-
Species reactivityHuman (Homo sapiens), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
-
Tested applicationsWB
-
Recommended dilutionsWestern blot: 0.1-0.5ug/ml
-
NotesOptimal dilution of the PTPN22 antibody should be determined by the researcher.
-
Intented useThis PTPN22 antibodyis to be used only for research purposes and not for diagnostics..
-
UniprotQ9Y2R2
-
PurityAntigen affinity
-
DescriptionProtein tyrosine phosphatase, non-receptor type 22 (lymphoid), also known as PTPN22, is a protein that in humans is encoded by the PTPN22 gene. This gene encodes of member of the non-receptor class 4 subfamily of the protein-tyrosine phosphatase family. The encoded protein is a lymphoid-specific intracellular phosphatase that associates with the molecular adapter protein CBL and may be involved in regulating CBL function in the T-cell receptor signaling pathway. Mutations in this gene may be associated with a range of autoimmune disorders including Type 1 Diabetes, rheumatoid arthritis, systemic lupus erythematosus and Graves' disease. Alternatively spliced transcript variants encoding distinct isoforms have been described.
-
ImmunogenAmino acids MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADK of human PTPN22 were used as the immunogen for the PTPN22 antibody.
-
StorageAfter reconstitution, the PTPN22 antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
-
PropertiesIf you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolPTPN22
-
Short nameAnti-PTPN22
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
IsotypeRabbit IgG
-
Alternative nameAntibodies to PTPN22
-
Alternative techniqueantibodies
-
Alternative to gene targetprotein tyrosine phosphatase, non-receptor type 22 (lymphoid), PTPN22 and IDBG-101222 and ENSG00000134242 and 26191, kinase binding, nuclei, Ptpn22 and IDBG-181952 and ENSMUSG00000027843 and 19260, PTPN22 and IDBG-634891 and ENSBTAG00000019617 and
-
Gene info
-
Identity
-
Gene
-
Long gene nameprotein tyrosine phosphatase non-receptor type 22
-
Synonyms gene
-
Synonyms gene name
- protein tyrosine phosphatase, non-receptor type 8
- protein tyrosine phosphatase, non-receptor type 22 (lymphoid)
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1999-11-26
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Protein tyrosine phosphatases non-receptor type
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data