PSMA1 Antibody

• Catalog number
  PB10087
• Price
  Please ask
• Size
  0,1 mg

• Target antigen
  PSMA1
• Clonality
  Polyclonal antibody
• Clone
  Polyclonal antibody
• Raised in
  rabbit
• Type of the antibody
  IgG polyclonal antibody
• Product form
  freeze-dried
• Reacts with species
  human, rat
• Analyses
  WB,IHC-P
• Immunogen
  A synthetic peptide corresponding to a sequence at the C-terminus of human PSMA1 (159-204aa MSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLP AEQD), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.
• Product configuration
  Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Purification
  Immunogen affinity purified.
• Solubilization
  The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
• Storage condtions
  Keep the PSMA1 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
• Tips
  The PSMA1 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
• Background
  Proteasome subunit alpha type-1 is a protein that in humans is encoded by the PSMA1 gene. The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
• Related articles
  1. Groll M, Ditzel L, Löwe J, Stock D, Bochtler M, Bartunik HD, Huber R (Apr 1997). "Structure of 20S proteasome from yeast at 2.4 A resolution". Nature 386 (6624): 463–71. 2. Tomko RJ, Hochstrasser M (2013). "Molecular architecture and assembly of the eukaryotic proteasome".Annual Review of Biochemistry 82: 415–45.
• Gene Name
  PSMA1
• Protein Name
  Proteasome subunit alpha type-1
• Gene Full Name
  proteasome subunit alpha 1
• Synonyms
  HC 2 | HC2 | PROS30 | PROS-30 | PROS 30 | PSC 2 | PSC2 | PSMA 1 | PSMA1 | P25786
• Uniprot ID
  P25786
• Entrez GeneID
  5682
• Properties
  If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  PSMA1  
• Gene symbol
  PSMA1
• Short name
  PSMA1 Antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  proteasome subunit alpha classification-1 isoform 3 (antibody to-)
• Alternative technique
  antibodies
• Alternative to gene target
  proteasome subunit alpha type-1 isoform 3, HC2 and HEL-S-275 and NU and PROS30, PSMA1 and IDBG-545891 and ENSG00000256206 and 5682, threonine-type endopeptidase activity, nuclei

Gene info

• Identity
  HGNC:9530
• Gene
  PSMA1
• Long gene name
  proteasome 20S subunit alpha 1
• Synonyms gene name
  • proteasome (prosome, macropain) subunit, alpha type, 1
  • proteasome subunit alpha 1
• Synonyms
  • HC2
  • NU
  • PROS30
  • MGC14542
  • MGC14575
  • MGC14751
  • MGC1667
  • MGC21459
  • MGC22853
  • MGC23915
• Synonyms name
  • proteasome subunit α6
• GenBank acession
  • X61969
• Locus
  11p15.2
• Discovery year
  1995-05-03
• Entrez gene record
  5682
• Pubmed identfication
  • 1398136
  • 2025653
• RefSeq identity
  • NM_002786
• Classification
  • Proteasome
• VEGA ID
  OTTHUMG00000165825

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products