PRKACA Blocking Peptide

• Catalog number
  33R-5755
• Price
  Please ask
• Size
  100 µg

• Category
  Proteins
• Antibody Subtype
  Blocking Peptides
• Area of research
  Protein Modification & Stress Response
• Residues
  MASNSSDVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRV
• Type of protein
  Synthetic
• Form Buffer
  Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
• Storage
  Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB; IHC
• URL
• More info
• Test
  You can block the antibody by the specific target amino acid sequence of peptide.
• Properties
  blocking peptide
• Description
  Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.

• Gene target
  PRKACA  
• Gene symbol
  PRKACA
• Short name
  PRKACA Blocking Peptide
• Technique
  blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
• Alternative name
  A synthetic peptide for use as a blocking control in assays to test for specificity of PRKACA antibody, catalog no. 70R-9553
• Alternative technique
  control, peptides
• Alternative to gene target
  protein kinase, cAMP-dependent, catalytic, alpha, PKACA, PRKACA and IDBG-32929 and ENSG00000072062 and 5566, transferase activity, nuclei, Prkaca and IDBG-173105 and ENSMUSG00000005469 and 18747, PRKACA and IDBG-642723 and ENSBTAG00000006642 and 282322

Gene info

• Identity
  HGNC:9380
• Gene
  PRKACA
• Long gene name
  protein kinase cAMP-activated catalytic subunit alpha
• Synonyms gene name
  • protein kinase, cAMP-dependent, catalytic, alpha
  • protein kinase, cAMP-dependent, alpha catalytic subunit
• Synonyms
  • PKACa
• Locus
  19p13.12
• Discovery year
  2001-06-22
• Entrez gene record
  5566
• Pubmed identfication
  • 8884279
• RefSeq identity
  • NM_002730
• Classification
  • AGC family kinases
• VEGA ID
  OTTHUMG00000182051

Similar products