PPT1 Antibody
-
Catalog numberR32123
-
PricePlease ask
-
Size0.1mg
-
-
CategoryAntibody
-
Concentration0.5mg/ml if reconstituted with 0.2ml sterile DI water
-
FormAntigen affinity purified
-
ConjugationUnconjugated
-
ClonePolyclonal antibody
-
Recognised antigenPPT1
-
Host animalRabbit (Oryctolagus cuniculus)
-
ClonalityPolyclonal (rabbit origin)
-
Species reactivityHuman (Homo sapiens), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
-
Tested applicationsWB, IHC-P
-
Recommended dilutionsWestern blot: 0.1-0.5ug/ml,IHC (Paraffin): 0.5-1ug/ml
-
NotesOptimal dilution of the PPT1 antibody should be determined by the researcher.
-
Intented useThis PPT1 antibodyis to be used only for research purposes and not for diagnostics..
-
UniprotP50897
-
PurityAntigen affinity
-
DescriptionPalmitoyl-protein thioesterase 1 (PPT-1), also known as palmitoyl-protein hydrolase 1, is an enzyme that in humans is encoded by the PPT1 gene. PPT-1 is a member of the palmitoyl protein thioesterase family. The protein encoded by this gene is a small glycoprotein involved in the catabolism of lipid-modified proteins during lysosomal degradation. The encoded enzyme removes thioester-linked fatty acyl groups such as palmitate from cysteine residues. Defects in this gene are a cause of infantile neuronal ceroid lipofuscinosis 1 (CLN1, or INCL) and neuronal ceroid lipofuscinosis 4 (CLN4). Two transcript variants encoding different isoforms have been found for this gene.
-
ImmunogenAmino acids KEDVYRNHSIFLADINQERGINESYKKNLMALKK of human PPT1 were used as the immunogen for the PPT1 antibody.
-
StorageAfter reconstitution, the PPT1 antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
-
LocalizationCytoplasmic
-
PropertiesIf you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolPPT1
-
Short nameAnti-PPT1
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
IsotypeRabbit IgG
-
Alternative nameAntibodies to PPT1
-
Alternative techniqueantibodies
-
Alternative to gene targetpalmitoyl-protein thioesterase 1, CLN1 and INCL and PPT, PPT1 and IDBG-96867 and ENSG00000131238 and 5538, palmitoyl-CoA hydrolase activity, nuclei, Ppt1 and IDBG-184539 and ENSMUSG00000028657 and 19063, BT.101768 and IDBG-640822 and ENSBTAG00000013367 and 281421
-
Gene info
-
Identity
-
Gene
-
Long gene namepalmitoyl-protein thioesterase 1
-
Synonyms gene
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2000-06-09
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Depalmitoylases
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data