PPP1R8 antibody

PPP1R8 antibody is available 5 times from Fitzgerald labs

70R-4732 | PPP1R8 antibodysize: 50 µg | 554.37 USD

Ajax processing

70R-1468 | PPP1R8 antibodysize: 100 µg | 454 USD

Ajax processing

70R-4733 | PPP1R8 antibodysize: 50 µg | 554.37 USD

  • Catalog number
    70R-4733
  • Supplier
  • Price
    554.37 USD
  • Size
    50 µg
  • Area of research
    Signal Transduction
  • Type of Immunogen
    PPP1R8 antibodies were raised using a synthetic peptide corresponding to a region with amino acids VDPSVGRFRNMVQTAVVPVKKKRVEGPGSLGLEESGSRRMQNFAFSGGLY
  • Cross Reactivity
    Human
  • Method of Purification
    Affinity purified
  • Concentration
    1 mg/ml
  • Form & Buffer
    Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PPP1R8 antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping conditions
    Blue Ice
  • Tested for
    WB
  • Usage Recommendations
    WB: 1 ug/ml
  • Assay Information
    PPP1R8 Blocking Peptide, catalog no. 33R-9473, is also available for use as a blocking control in assays to test for specificity of this PPP1R8 antibody
  • Additional Information
    This is a rabbit polyclonal antibody against PPP1R8, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at antibodies@fitzgerald-fii.com
1. Gene info
MeSH Data
  • Name
  • Concept
    Scope note:Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
Additional information

70R-1314 | PPP1R8 antibodysize: 100 µg | 454 USD

Ajax processing

70R-19477 | PPP1R8 antibodysize: 50 µl | 597.56 USD

Ajax processing
  • Category
    Primary Antibody
  • Antibody Subtype
    Polyclonal Antibodies, Purified
  • Raised in
    Rabbit
  • Product Type
    Primary Antibodies
  • Product Subtype
    Purified Polyclonal Antibodies
  • Properties
    If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
    anticorps
  • Gene target
  • Short name
    PPP1R8 antibody
  • Technique
    Antibody
  • Alternative name
    PPP1R8 (Antibody to)
  • Alternative technique
    antibodies
Simillar products
Supplier:Cusabio
Price:196.07USD
Supplier:MyBioSource
Price:387.48USD
Supplier:abbex
Price:473.84USD
Supplier:SAB
Price:500.69USD
Supplier:abbex
Price:115.54USD
Supplier:Assay Biotech
Price:379.31USD
Supplier:genways
Price:479.68USD
Supplier:MyBioSource
Price:0.00USD
Supplier:EnoGene
Price:437.66USD
Supplier:SAB
Price:395.65USD
Supplier:Kamiya
Price:581.22USD
Supplier:MyBioSource
Price:0.00USD
Supplier:SFC
Price:0.00USD
Supplier:Zyagen
Price:238.09USD
Supplier:MyBioSource
Price:528.70USD
Filters
+32-(0)1-658-90-45 lieven@gentaur.com
PPP1R8 antibody - Gentaur.com
Contact
Chat with gentaur.com employee