SMAD1 Antibody
-
Catalog numberPB9395
-
PricePlease ask
-
Size0,1 mg
-
-
Target antigenSMAD1
-
ClonalityPolyclonal antibody
-
ClonePolyclonal antibody
-
Raised inrabbit
-
Type of the antibodyIgG polyclonal antibody
-
Product formfreeze-dried
-
Reacts with specieshuman, mouse, rat
-
AnalysesWB
-
ImmunogenA synthetic peptide corresponding to a sequence in the middle region of human SMAD1 (240-270aa QPMDTNMMAPPLPSEINRGDVQAVAYEEPKH), different from the related mouse sequence by two amino acids, and from the related rat sequence by five amino acids.
-
Product configurationEach vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
PurificationImmunogen affinity purified.
-
SolubilizationThe powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtionsKeep the SMAD1 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
TipsThe SMAD1 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
BackgroundSMADs are proteins that modulate the activity of transforming growth factor beta ligands. The SMADs, often in complex with other SMADs/CoSMAD, act as transcription factors that regulate the expression of certain genes. It was concluded that targeted ubiquitination of SMADs may serve to control both embryonic development and a wide variety of cellular responses to TGF-beta signals. R-Smads or receptor regulated Smads are a class of proteins that include SMAD1, SMAD2, SMAD3, SMAD5, and SMAD8. In response to signals by the TGF-β superfamily of ligands these proteins associate with receptor kinases and are phosphorylated at an SSXS motif at their extreme C-terminus. These proteins then typically bind to the common mediator Smad or co-SMAD SMAD4.
-
Related articles1. Zhu, H., Kavsak, P., Abdollah, S., Wrana, J. L., Thomsen, G. H. A SMAD ubiquitin ligase targets the BMP pathway and affects embryonic pattern formation. Nature 400: 687-693, 1999.
-
Gene NameSMAD1
-
Protein NameMothers against decapentaplegic homolog 1
-
Gene Full NameSMAD family member 1
-
SynonymsBSP 1 | BSP1 | BSP-1 | BSP1 | MADH1 | MADR1 | HsMAD1 | JV4 1 | JV4-1 | MADH1 | Madh1 | Madr1 | Q15797 | SMAD1
-
Uniprot IDQ15797
-
Entrez GeneID4086
-
PropertiesIf you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolSMAD1-AS2, SMAD1-AS1, SMAD1, GARS1
-
Short nameSMAD1 Antibody
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
Alternative nameSMAD family member 1 (antibody to-)
-
Alternative techniqueantibodies
-
Alternative to gene targetSMAD family member 1, BSP-1 and BSP1 and JV4-1 and JV41 and MADH1 and MADR1, SMAD1 and IDBG-39936 and ENSG00000170365 and 4086, transforming growth factor beta receptor, nuclei, Smad1 and IDBG-170516 and ENSMUSG00000031681 and 17125, SMAD1 and IDBG-629431 and ENSBTAG00000002835 and 540488
-
Gene info
-
Identity
-
Gene
-
Long gene nameSMAD1 antisense RNA 2
-
GenBank acession
-
Locus
-
Discovery year2013-10-22
-
Entrez gene record
-
Classification
- Antisense RNAs
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameSMAD1 antisense RNA 1
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2013-10-22
-
Pubmed identfication
-
Classification
- Antisense RNAs
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameSMAD family member 1
-
Synonyms gene
-
Synonyms gene name
- MAD, mothers against decapentaplegic homolog 1 (Drosophila)
- SMAD, mothers against DPP homolog 1 (Drosophila)
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1996-11-15
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- SMAD family
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameglycyl-tRNA synthetase 1
-
Synonyms gene
-
Synonyms gene name
- Charcot-Marie-Tooth neuropathy 2D
- glycyl-tRNA synthetase
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1995-03-21
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Aminoacyl tRNA synthetases, Class II
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data