LIFR Antibody

• Catalog number
  PB9661
• Price
  Please ask
• Size
  0,1 mg

• Target antigen
  LIFR
• Clonality
  Polyclonal antibody
• Clone
  Polyclonal antibody
• Raised in
  rabbit
• Type of the antibody
  IgG polyclonal antibody
• Product form
  freeze-dried
• Reacts with species
  human, mouse, rat
• Analyses
  WB
• Immunogen
  A synthetic peptide corresponding to a sequence at the C-terminus of human LIFR(863-899aa EWIKETFYPDIPNPENCKALQFQKSVCEGSSALKTLE), different from the related mouse and rat sequences by one amino acid.
• Product configuration
  Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Purification
  Immunogen affinity purified.
• Solubilization
  The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
• Storage condtions
  Keep the LIFR Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
• Tips
  The LIFR Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
• Background
  LIFR also known as CD118 (Cluster of Differentiation 118), is a subunit of a receptor for leukemia inhibitory factor. This gene encodes a protein that belongs to the type I cytokine receptor family. This protein combines with a high-affinity converter subunit, gp130, to form a receptor complex that mediates the action of the leukemia inhibitory factor, a polyfunctional cytokine that is involved in cellular differentiation, proliferation and survival in the adult and the embryo. Mutations in this gene cause Schwartz-Jampel syndrome type 2, a disease belonging to the group of the bent-bone dysplasias. A translocation that involves the promoter of this gene, t(5;8)(p13;q12) with the pleiomorphic adenoma gene 1, is associated with salivary gland pleiomorphic adenoma, a common type of benign epithelial tumor of the salivary gland. Multiple splice variants encoding the same protein have been found for this gene.
• Related articles
  1. "Entrez Gene: LIFR leukemia inhibitory factor receptor alpha". 2. Lass A, Weiser W, Munafo A, Loumaye E (2002). "Leukemia inhibitory factor in human reproduction". Fertil. Steril. 76 (6): 1091–6. 3. Tomida M (2003). "Structural and functional studies on the leukemia inhibitory factor receptor (LIF-R): gene and soluble form of LIF-R, and cytoplasmic domain of LIF-R required for differentiation and growth arrest of myeloid leukemic cells.". Leuk. Lymphoma 37 (5–6): 517–25.
• Gene Name
  LIFR
• Protein Name
  Leukemia inhibitory factor receptor
• Gene Full Name
  leukemia inhibitory factor receptor alpha
• Synonyms
  CD118 antibody|CD118 antigen antibody|FLJ98106 antibody|FLJ99923 antibody|Leukemia inhibitory factor receptor alpha antibody|Leukemia inhibitory factor receptor antibody|LIF R antibody|LIF receptor antibody|LIF-R antibody|Lifr antibody|LIFR_HUMAN antibody|SJS2 antibody|STWS antibody|SWS antibody
• Uniprot ID
  P42702
• Entrez GeneID
  3977
• Properties
  If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  LIFR  
• Gene symbol
  LIFR-AS1, LIFR
• Short name
  LIFR Antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  leukemia inhibitory factor receptor alpha (antibody to-)
• Alternative technique
  antibodies
• Alternative to gene target
  leukemia inhibitory factor receptor alpha, CD118 and LIF-R and SJS2 and STWS and SWS, LIFR and IDBG-17489 and ENSG00000113594 and 3977, growth factor binding, Extracellular, Lifr and IDBG-128297 and ENSMUSG00000054263 and 16880, LIFR and IDBG-630017 and ENSBTAG00000010423 and 539504

Gene info

• Identity
  HGNC:43600
• Gene
  LIFR-AS1
• Long gene name
  LIFR antisense RNA 1
• Synonyms gene name
  • LIFR antisense RNA 1 (non-protein coding)
• GenBank acession
  • BC038371
• Locus
  5p13.1
• Discovery year
  2011-11-23
• Entrez gene record
  100506495
• Pubmed identfication
  • 26725846
  • 29807108
• Classification
  • Antisense RNAs
• VEGA ID
  OTTHUMG00000162109

Gene info

• Identity
  HGNC:6597
• Gene
  LIFR
• Long gene name
  LIF receptor subunit alpha
• Synonyms gene name
  • leukemia inhibitory factor receptor
  • leukemia inhibitory factor receptor alpha
  • LIF receptor alpha
• Synonyms
  • CD118
• GenBank acession
  • X61615
• Locus
  5p13.1
• Discovery year
  1992-08-24
• Entrez gene record
  3977
• Pubmed identfication
  • 1915266
• RefSeq identity
  • NM_002310
• Classification
  • Fibronectin type III domain containing
  • CD molecules
  • MicroRNA protein coding host genes
• VEGA ID
  OTTHUMG00000131138

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products