Irf2bp1 Blocking Peptide

1x Irf2bp1 Blocking Peptide found in fitzgerald

  • Category
    Proteins
  • Antibody Subtype
    Blocking Peptides
  • Area of research
    Signal Transduction
  • Residues
    ALTLAPGLSPARPLFGSDFEKEKQQRNADCLAELNEAMRGRAEEWHGRPK
  • Type of protein
    Synthetic
  • Form & Buffer
    Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
  • Storage
    Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
  • Shipping conditions
    Blue Ice
  • Tested for
    WB; IHC
  • Gene target
  • Short name
    Irf2bp1 Blocking Peptide
  • Technique
    blocking peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
  • Alternative name
    interferon regulatory factor 2 binding protein 1 inhibiting short protein sequence
  • Alternative technique
    control
  • Alternative to gene target
    interferon regulatory factor 2 binding protein 1, IRF2BP1 and IDBG-58309 and ENSG00000170604 and 26145, this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0006351 and transcription, DNA-templated and biological process this GO :0006355 and regulation of transcription, DNA-templated and biological process this GO :0016874 and ligase activity and molecular function this GO :0045087 and innate immune response and biological process this GO :0046872 and metal ion binding and molecular function, metal ion binding, this GO :0005515: protein binding and also this GO :0016874: ligase activity and also this GO :0046872: metal ion binding, this GO :0005515: protein binding, this GO :0016874: ligase activity, this GO :0046872: metal ion binding, nuclei, Irf2bp1 and IDBG-149056 and ENSMUSG00000044030 and 272359, IRF2BP1 and IDBG-647707 and ENSBTAG00000000154 and 523963

33R-1374 | Irf2bp1 Blocking Peptide100 µg 257.82 USD

Ajax processing
Simillar products
Supplier:ABM CrispR
Price:7 146.44USD
Supplier:fitzgerald
Price:628.58USD
Supplier:MBS Recombinant
Price:1 614.43USD
Supplier:Gentaur Genprice
Price:537.73USD
Supplier:abbex
Price:352.35USD
Supplier:ABM microrna
Price:583.16USD
Supplier:Elabscience
Price:697.33USD
Supplier:genways bulk
Price:0.00USD
Supplier:abbex
Price:729.25USD
Supplier:abbex
Price:331.48USD
Supplier:trca
Price:329.02USD
Supplier:MBS Monoclonals
Price:644.54USD
Supplier:MBS Recombinant
Price:2 408.75USD
Supplier:MBS Recombinant
Price:2 062.54USD
Filters
+32-(0)1-658-90-45 lieven@gentaur.com
Irf2bp1 Blocking Peptide - Gentaur.com
Contact
Chat with gentaur.com employee