Irf2bp1 Blocking Peptide

Irf2bp1 Blocking Peptide is available 2 times from Fitzgerald labs

33R-1374 | Irf2bp1 Blocking Peptidesize: 100 ug | 322.95 USD

Ajax processing

33R-1374 | Irf2bp1 Blocking Peptidesize: 100 µg | 242.21 USD

Ajax processing
  • Product Type
    Proteins
  • Product Subtype
    Blocking Peptides
  • Research Area
    Signal Transduction
  • Tag/Conjugate
    ALTLAPGLSPARPLFGSDFEKEKQQRNADCLAELNEAMRGRAEEWHGRPK
  • Type1
    Synthetic
  • Form & Buffer
    Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
  • Storage
    Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
  • Applications
    WB, IHC
  • Shipping Info
    Blue Ice
  • Category
    Proteins
  • Antibody Subtype
    Blocking Peptides
  • Area of research
    Signal Transduction
  • Residues
    ALTLAPGLSPARPLFGSDFEKEKQQRNADCLAELNEAMRGRAEEWHGRPK
  • Type of protein
    Synthetic
  • Shipping conditions
    Blue Ice
  • Tested for
    WB; IHC
  • Test
    You can block the antibody by the specific target amino acid sequence of peptide.
  • Properties
    blocking peptide
  • Description
    Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.
  • Gene target
  • Short name
    Irf2bp1 Blocking Peptide
  • Technique
    blocking peptide, Blocking, peptide
  • Alternative name
    interferon regulatory factor 2 binding protein 1 inhibiting short protein sequence
  • Alternative technique
    control
  • Alternative to gene target
    interferon regulatory factor 2 binding protein 1, IRF2BP1 and IDBG-58309 and ENSG00000170604 and 26145, metal ion binding, nuclei, Irf2bp1 and IDBG-149056 and ENSMUSG00000044030 and 272359, IRF2BP1 and IDBG-647707 and ENSBTAG00000000154 and 523963
Simillar products
Supplier:fitzgerald
Price:242.21USD
Supplier:Gentaur Genprice
Price:349.48USD
Supplier:Bioss Primary Conjugated Antibodies. ALEXA FLUOR
Price:383.79USD
Supplier:Assay Biotech
Price:743.94USD
Supplier:ABM lentivectors
Price:371.97USD
Supplier:aat
Price:253.34USD
Supplier:MyBioSource
Price:0.00USD
Supplier:MyBioSource
Price:0.00USD
Supplier:trca
Price:208.77USD
Supplier:Elabscience
Price:124.52USD
Supplier:fitzgerald
Price:242.21USD
Filters
+32-(0)1-658-90-45 lieven@gentaur.com
Irf2bp1 Blocking Peptide - Gentaur.com
Contact
Chat with gentaur.com employee