IL7R Antibody / CD127

• Catalog number
  R32384
• Price
  Please ask
• Size
  0.1mg

• Category
  Antibody
• Concentration
  0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Form
  Antigen affinity purified
• Conjugation
  Unconjugated
• Clone
  Polyclonal antibody
• Recognised antigen
  IL7R / CD127
• Host animal
  Rabbit (Oryctolagus cuniculus)
• Clonality
  Polyclonal (rabbit origin)
• Species reactivity
  Human (Homo sapiens), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
• Tested applications
  WB
• Recommended dilutions
  Western blot: 0.1-0.5ug/ml
• Intented use
  This IL7R antibodyis to be used only for research purposes and not for diagnostics..
• Uniprot
  P16871
• Purity
  Antigen affinity
• Description
  The interleukin-7 receptor, also known as IL7R alpha, is a protein found on the surface of cells. It is mapped to 5p13. Interleukin-7 receptor has been shown to play a critical role in the development of immune cells called lymphocytes - specifically in a process known as V(D)J recombination. This protein is also found to control the accessibility of a region of the genome that contains the T-cell receptor gamma gene, by STAT5 and histone acetylation. Knockout studies in mice suggest that blocking apoptosis is an essential function of this protein during differentiation and activation of T lymphocytes. Functional defects in this protein may be associated with the pathogenesis of severe combined immunodeficiency (SCID).
• Immunogen
  Amino acids DHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQ from IL7R alpha were used as the immunogen for the IL7R antibody.
• Storage
  After reconstitution, the IL7R antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
• Properties
  If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  IL7R   CD127  
• Gene symbol
  IL7R
• Short name
  Anti-IL7R / CD127
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Isotype
  Rabbit IgG
• Alternative name
  Antibodies to IL7R / CD127
• Alternative technique
  antibodies
• Alternative to gene target
  interleukin 7 receptor, CD127 and CDW127 and IL-7R-alpha and IL7RA and ILRA, IL7R and IDBG-16161 and ENSG00000168685 and 3575, protein binding, Extracellular, Il7r and IDBG-129135 and ENSMUSG00000003882 and 16197, IL7R and IDBG-630353 and ENSBTAG00000019975 and 521554

Gene info

• Identity
  HGNC:6024
• Gene
  IL7R
• Long gene name
  interleukin 7 receptor
• Synonyms
  • CD127
  • IL7RA
• GenBank acession
  • M29696
• Locus
  5p13.2
• Discovery year
  1991-08-07
• Entrez gene record
  3575
• Pubmed identfication
  • 2317865
• Classification
  • Interleukin receptors
  • Fibronectin type III domain containing
  • CD molecules
• VEGA ID
  OTTHUMG00000090791
• Locus Specific Databases
  • IL7Rbase: Mutation registry for Interleukin-7 receptor α deficiency
  • LRG_74

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products