AIF Antibody
-
Catalog numberPB9366
-
PricePlease ask
-
Size0,1 mg
-
-
Target antigenAIF
-
ClonalityPolyclonal antibody
-
ClonePolyclonal antibody
-
Raised inrabbit
-
Type of the antibodyIgG polyclonal antibody
-
Product formfreeze-dried
-
Reacts with specieshuman
-
AnalysesWB,IHC-P,ICC
-
ImmunogenA synthetic peptide corresponding to a sequence at the C-terminus of human AIF(582-613aa FNRMPIARKIIKDGEQHEDLNEVAKLFNIHED), identical to the related mouse and rat sequences.
-
Product configurationEach vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
PurificationImmunogen affinity purified.
-
SolubilizationThe powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtionsKeep the AIF Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
TipsThe AIF Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
BackgroundApoptosis-inducing factor 1, mitochondrial, also known as AIF or PDCD8 is a protein that in humans is encoded by the AIFM1 gene. AIFM1 gene is mapped to Xq26.1 based on an alignment of the AIFM1 sequence with the genomic sequence. This gene encodes a flavoprotein essential for nuclear disassembly in apoptotic cells, and it is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it affects chromosome condensation and fragmentation. In addition, this gene product induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9. Mutations in this gene cause combined oxidative phosphorylation deficiency 6, which results in a severe mitochondrial encephalomyopathy. A related pseudogene has been identified on chromosome 10.
-
Related articles1. Ghezzi, D., Sevrioukova, I., Invernizzi, F., Lamperti, C., Mora, M., D'Adamo, P., Novara, F., Zuffardi, O., Uziel, G., Zeviani, M. Severe X-linked mitochondrial encephalomyopathy associated with a mutation in apoptosis-inducing factor. Am. J. Hum. Genet. 86: 639-649, 2010. 2. Rinaldi, C., Grunseich, C., Sevrioukova, I. F., Schindler, A., Horkayne-Szakaly, I., Lamperti, C., Landoure, G., Kennerson, M. L., Burnett, B. G., Bonnemann, C., Biesecker, L. G., Ghezzi, D., Zeviani, M., Fischbeck, K. H. Cowchock syndrome is associated with a mutation in apoptosis-inducing factor. Am. J. Hum. Genet. 91: 1095-1102, 2012. 3. Yu, S.-W., Andrabi, S. A., Wang, H., Kim, N. S., Poirier, G. G., Dawson, T. M., Dawson, V. L. Apoptosis-inducing factor mediates poly(ADP-ribose) (PAR) polymer-induced cell death. Proc. Nat. Acad. Sci. 103: 18314-18319, 2006.
-
Gene NameAIFM1
-
Protein NameApoptosis-inducing factor 1, mitochondrial
-
Gene Full Nameapoptosis-inducing factor, mitochondrion-associated, 1
-
SynonymsAIFM1 antibody|AIFM1_HUMAN antibody|Apoptosis inducing factor 1, mitochondrial antibody|Apoptosis inducing factor antibody|Apoptosis inducing factor, mitochondrion associated, 1 antibody|Apoptosis-inducing factor 1 antibody|CMTX4 antibody|COXPD6 antibody|Harlequin antibody|Hq antibody|mAIF antibody|MGC111425 antibody|MGC5706 antibody|mitochondrial antibody|Neuropathy, axonal motor-sensory, with deafness and mental retardation antibody|neuropathy, axonal, motor-sensory with deafness and mental retardation (Cowchock syndrome) antibody|PDCD 8 antibody|PDCD8 antibody|Programmed cell death 8 (apoptosis inducing factor) antibody|Programmed cell death 8 antibody|Programmed cell death 8 isoform 1 antibody|Programmed cell death 8 isoform 2 antibody|Programmed cell death 8 isoform 3 antibody|Programmed cell death protein 8 antibody|Programmed cell death protein 8 mitochondrial antibody|Programmed cell death protein 8 mitochondrial precursor antibody|Striatal apoptosis inducing factor antibody
-
Uniprot IDO95831
-
Entrez GeneID9131
-
PropertiesIf you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolAIF1, AIFM1
-
Short nameAIF Antibody
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
Alternative nameAIF (antibody to-)
-
Alternative techniqueantibodies
-
Gene info
-
Identity
-
Gene
-
Long gene nameallograft inflammatory factor 1
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1997-07-01
-
Entrez gene record
-
Pubmed identfication
-
Classification
- EF-hand domain containing
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameapoptosis inducing factor mitochondria associated 1
-
Synonyms gene
-
Synonyms gene name
- programmed cell death 8 (apoptosis-inducing factor)
- neuropathy, axonal, motor-sensory with deafness and mental retardation (Cowchock syndrome)
- apoptosis-inducing factor, mitochondrion-associated, 1
- apoptosis inducing factor, mitochondria associated 1
- auditory neuropathy, X-linked recessive 1
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1999-05-28
-
Entrez gene record
-
Pubmed identfication
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
