GRK6 Antibody

• Catalog number
  R32102
• Price
  Please ask
• Size
  0.1mg

• Category
  Antibody
• Concentration
  0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Form
  Antigen affinity purified
• Conjugation
  Unconjugated
• Clone
  Polyclonal antibody
• Recognised antigen
  GRK6
• Host animal
  Rabbit (Oryctolagus cuniculus)
• Clonality
  Polyclonal (rabbit origin)
• Species reactivity
  Human (Homo sapiens), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
• Tested applications
  WB
• Recommended dilutions
  Western blot: 0.1-0.5ug/ml
• Notes
  Optimal dilution of the GRK6 antibody should be determined by the researcher.
• Intented use
  This GRK6 antibodyis to be used only for research purposes and not for diagnostics..
• Uniprot
  P43250
• Purity
  Antigen affinity
• Description
  G protein-coupled receptor kinase 6 is an enzyme that in humans is encoded by the GRK6 gene. It is mapped to 5q35. This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. Several transcript variants encoding different isoforms have been described for this gene. Also, GRK6 appears to be involved in responses tomorphine.
• Immunogen
  Amino acids QSPFQQRKKKIKREEVERLVKEVPEEYSERFSPQAR of human GRK6 were used as the immunogen for the GRK6 antibody.
• Storage
  After reconstitution, the GRK6 antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
• Properties
  If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  GRK6  
• Gene symbol
  GRK6
• Short name
  Anti-GRK6
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Isotype
  Rabbit IgG
• Alternative name
  Antibodies to GRK6
• Alternative technique
  antibodies

Gene info

• Identity
  HGNC:4545
• Gene
  GRK6
• Long gene name
  G protein-coupled receptor kinase 6
• Synonyms gene
  • GPRK6
• Locus
  5q35.3
• Discovery year
  1994-03-29
• Entrez gene record
  2870
• Pubmed identfication
  • 8415712
• RefSeq identity
  • NM_002082
• Classification
  • AGC family kinases
• VEGA ID
  OTTHUMG00000163401

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products